Human MSRA/PMSR ORF/cDNA clone-Lentivirus plasmid (NM_012331)

Cat. No.: pGMLP000029
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MSRA/PMSR Lentiviral expression plasmid for MSRA lentivirus packaging, MSRA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MSRA/PMSR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $477
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000029
Gene Name MSRA
Accession Number NM_012331
Gene ID 4482
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 708 bp
Gene Alias PMSR
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTCTCGGCCACCCGGAGGGCTTGCCAGCTCCTCCTCCTCCACAGCCTCTTTCCCGTCCCGAGGATGGGCAACTCGGCCTCGAACATCGTCAGCCCCCAGGAGGCCTTGCCGGGCCGGAAGGAACAGACCCCTGTAGCGGCCAAACATCATGTCAATGGCAACAGAACAGTCGAACCTTTCCCAGAGGGAACACAGATGGCTGTATTTGGAATGGGATGTTTCTGGGGAGCTGAAAGGAAATTCTGGGTCTTGAAAGGAGTGTATTCAACTCAAGTTGGTTTTGCAGGAGGCTATACTTCAAATCCTACTTATAAAGAAGTCTGCTCAGAAAAAACTGGCCATGCAGAAGTCGTCCGAGTGGTGTACCAGCCAGAACACATGAGTTTTGAGGAACTGCTCAAGGTCTTCTGGGAGAATCACGACCCGACCCAAGGTATGCGCCAGGGGAACGACCATGGCACTCAGTACCGCTCGGCCATCTACCCGACCTCTGCCAAGCAAATGGAGGCAGCCCTGAGCTCCAAAGAGAACTACCAAAAGGTTCTTTCAGAGCACGGCTTCGGCCCCATCACTACCGACATCCGGGAGGGACAGACTTTCTACTATGCGGAAGACTACCACCAGCAGTACCTGAGCAAGAACCCCAATGGCTACTGCGGCCTTGGGGGCACCGGCGTGTCCTGCCCAGTGGGTATTAAAAAATAA
ORF Protein Sequence MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2600-Ab Anti-MSRA/ PMSR monoclonal antibody
    Target Antigen GM-Tg-g-MP2600-Ag MSRA VLP (virus-like particle)
    ORF Viral Vector pGMLP000029 Human MSRA Lentivirus plasmid
    ORF Viral Vector pGMAD001617 Human MSRA Adenovirus plasmid
    ORF Viral Vector vGMLP000029 Human MSRA Lentivirus particle
    ORF Viral Vector vGMAD001617 Human MSRA Adenovirus particle


    Target information

    Target ID GM-MP2600
    Target Name MSRA
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4482
    Gene ID 100061773 (Equus caballus), 101082232 (Felis catus), 110265 (Mus musculus), 281312 (Bos taurus)
    29447 (Rattus norvegicus), 4482 (Homo sapiens), 608103 (Canis lupus familiaris), 698628 (Macaca mulatta)
    Gene Symbols & Synonyms MSRA,Msra,MSR-A,2310045J23Rik,6530413P12Rik,PMSR
    Target Alternative Names 2310045J23Rik,6530413P12Rik,MSR-A,MSRA,Mitochondrial peptide methionine sulfoxide reductase,Msra,PMSR,Peptide-methionine (S)-S-oxide reductase (Peptide Met(O) reductase),Protein-methionine-S-oxide reductase (PMSR)
    Uniprot Accession P54149,Q923M1,Q9D6Y7,Q9UJ68
    Additional SwissProt Accessions: Q9D6Y7,P54149,Q923M1,Q9UJ68
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease Prostate Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000001697, ENSMUSG00000054733, ENSBTAG00000021632, ENSG00000175806, ENSCAFG00845020456, ENSMMUG00000012043
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.