Human PTP4A1/HH72/PRL-1 ORF/cDNA clone-Lentivirus plasmid (NM_003463)

Cat. No.: pGMLP000042
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PTP4A1/HH72/PRL-1 Lentiviral expression plasmid for PTP4A1 lentivirus packaging, PTP4A1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PTP4A1/PRL1/PRL-1/PTP4A1/HH72 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $430.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000042
Gene Name PTP4A1
Accession Number NM_003463
Gene ID 7803
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 522 bp
Gene Alias HH72,PRL-1,PRL1,PTP(CAAX1),PTPCAAX1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCGAATGAACCGCCCAGCTCCTGTGGAAGTCACATACAAGAACATGAGATTTCTTATTACACACAATCCAACCAATGCGACCTTAAACAAATTTATAGAGGAACTTAAGAAGTATGGAGTTACCACAATAGTAAGAGTATGTGAAGCAACTTATGACACTACTCTTGTGGAGAAAGAAGGTATCCATGTTCTTGATTGGCCTTTTGATGATGGTGCACCACCATCCAACCAGATTGTTGATGACTGGTTAAGTCTTGTGAAAATTAAGTTTCGTGAAGAACCTGGTTGTTGTATTGCTGTTCATTGCGTTGCAGGCCTTGGGAGAGCTCCAGTACTTGTTGCCCTAGCATTAATTGAAGGTGGAATGAAATACGAAGATGCAGTACAATTCATAAGACAAAAGCGGCGTGGAGCTTTTAACAGCAAGCAACTTCTGTATTTGGAGAAGTATCGTCCTAAAATGCGGCTGCGTTTCAAAGATTCCAACGGTCATAGAAACAACTGTTGCATTCAATAA
ORF Protein Sequence MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T85328-Ab Anti-PRL-1 monoclonal antibody
    Target Antigen GM-Tg-g-T85328-Ag PRL-1/PTP4A1 protein
    ORF Viral Vector pGMLP000042 Human PTP4A1 Lentivirus plasmid
    ORF Viral Vector vGMLP000042 Human PTP4A1 Lentivirus particle


    Target information

    Target ID GM-T85328
    Target Name PTP4A1/PRL1/PRL-1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7803
    Gene ID 100057042 (Equus caballus), 101081047 (Felis catus), 19243 (Mus musculus), 29463 (Rattus norvegicus)
    481863 (Canis lupus familiaris), 613326 (Bos taurus), 716195 (Macaca mulatta), 7803 (Homo sapiens)
    Gene Symbols & Synonyms PTP4A1,Ptp4a1,Prl-1,C130021B01,PRL-1,HH72,PRL1,PTPCAAX1,PTP(CAAX1)
    Target Alternative Names C130021B01,HH72,PRL-1,PRL1,PTP(CAAX1),PTP(CAAXI),PTP4A1,PTPCAAX1,Prl-1,Protein tyrosine phosphatase type IVA 1,Protein-tyrosine phosphatase 4a1,Protein-tyrosine phosphatase of regenerating liver 1 (PRL-1),Ptp4a1
    Uniprot Accession Q63739,Q78EG7,Q93096
    Additional SwissProt Accessions: Q63739,Q78EG7,Q93096
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000022483, ENSMUSG00000026064,ENSMUSG00000117310, ENSCAFG00845007421, ENSBTAG00000002275, ENSMMUG00000002777, ENSG00000112245
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.