Human TIMP4/TIMP-4 ORF/cDNA clone-Lentivirus plasmid (NM_003256)

Cat. No.: pGMLP000048
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TIMP4/TIMP-4 Lentiviral expression plasmid for TIMP4 lentivirus packaging, TIMP4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TIMP-4/TIMP4/TIMP4/TIMP-4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $468.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000048
Gene Name TIMP4
Accession Number NM_003256
Gene ID 7079
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 675 bp
Gene Alias TIMP-4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTGGGAGCCCTCGGCCCGCGCCAAGCTGGGTGCTGTTGCTGCGGCTGCTGGCGTTGCTGCGGCCCCCGGGGCTGGGTGAGGCATGCAGCTGCGCCCCGGCGCACCCTCAGCAGCACATCTGCCACTCGGCACTTGTGATTCGGGCCAAAATCTCCAGTGAGAAGGTAGTTCCGGCCAGTGCAGACCCTGCTGACACTGAAAAAATGCTCCGGTATGAAATCAAACAGATAAAGATGTTCAAAGGGTTTGAGAAAGTCAAGGATGTTCAGTATATCTATACGCCTTTTGACTCTTCCCTCTGTGGTGTGAAACTAGAAGCCAACAGCCAGAAGCAGTATCTCTTGACTGGTCAGGTCCTCAGTGATGGAAAAGTCTTCATCCATCTGTGCAACTACATCGAGCCCTGGGAGGACCTGTCCTTGGTGCAGAGGGAAAGTCTGAATCATCACTACCATCTGAACTGTGGCTGCCAAATCACCACCTGCTACACAGTACCCTGTACCATCTCGGCCCCTAACGAGTGCCTCTGGACAGACTGGCTGTTGGAACGAAAGCTCTATGGTTACCAGGCTCAGCATTATGTCTGTATGAAGCATGTTGACGGCACCTGCAGCTGGTACCGGGGCCACCTGCCTCTCAGGAAGGAGTTTGTTGACATCGTTCAGCCCTAG
ORF Protein Sequence MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1340-Ab Anti-TIMP4/ TIMP-4 functional antibody
    Target Antigen GM-Tg-g-SE1340-Ag TIMP4 protein
    ORF Viral Vector pGMLP000048 Human TIMP4 Lentivirus plasmid
    ORF Viral Vector vGMLP000048 Human TIMP4 Lentivirus particle


    Target information

    Target ID GM-SE1340
    Target Name TIMP-4/TIMP4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7079
    Gene ID 100051332 (Equus caballus), 100427947 (Macaca mulatta), 100688494 (Canis lupus familiaris), 101094660 (Felis catus)
    110595 (Mus musculus), 317694 (Bos taurus), 680130 (Rattus norvegicus), 7079 (Homo sapiens)
    Gene Symbols & Synonyms TIMP4,Timp4,Timp-4,TIMP-4
    Target Alternative Names Metalloproteinase inhibitor 4,TIMP-4,TIMP4,Timp-4,Timp4,Tissue inhibitor of metalloproteinases 4 (TIMP-4)
    Uniprot Accession O97563,P81556,Q99727,Q9JHB3
    Additional SwissProt Accessions: Q9JHB3,O97563,P81556,Q99727
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000011609, ENSMMUG00000001127, ENSCAFG00845029189, ENSMUSG00000030317, ENSBTAG00000020263, ENSG00000157150
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.