Human CXCL1/FSP/GRO1 ORF/cDNA clone-Lentivirus plasmid (NM_001511)

Cat. No.: pGMLP000056
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CXCL1/FSP/GRO1 Lentiviral expression plasmid for CXCL1 lentivirus packaging, CXCL1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CXCL1/FSP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000056
Gene Name CXCL1
Accession Number NM_001511
Gene ID 2919
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 324 bp
Gene Alias FSP,GRO1,GROa,MGSA,MGSA-a,NAP-3,SCYB1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCGCGCTGCTCTCTCCGCCGCCCCCAGCAATCCCCGGCTCCTGCGAGTGGCACTGCTGCTCCTGCTCCTGGTAGCCGCTGGCCGGCGCGCAGCAGGAGCGTCCGTGGCCACTGAACTGCGCTGCCAGTGCTTGCAGACCCTGCAGGGAATTCACCCCAAGAACATCCAAAGTGTGAACGTGAAGTCCCCCGGACCCCACTGCGCCCAAACCGAAGTCATAGCCACACTCAAGAATGGGCGGAAAGCTTGCCTCAATCCTGCATCCCCCATAGTTAAGAAAATCATCGAAAAGATGCTGAACAGTGACAAATCCAACTGA
ORF Protein Sequence MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T96005-Ab Anti-GROA/ CXCL1/ FSP functional antibody
    Target Antigen GM-Tg-g-T96005-Ag CXCL1 protein
    Cytokine cks-Tg-g-GM-T96005 chemokine (C-X-C motif) ligand 1 (CXCL1) protein & antibody
    ORF Viral Vector pGMLP000056 Human CXCL1 Lentivirus plasmid
    ORF Viral Vector pGMAD001667 Human CXCL1 Adenovirus plasmid
    ORF Viral Vector vGMLP000056 Human CXCL1 Lentivirus particle
    ORF Viral Vector vGMAD001667 Human CXCL1 Adenovirus particle


    Target information

    Target ID GM-T96005
    Target Name CXCL1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2919
    Gene ID 2919 (Homo sapiens), 574222 (Macaca mulatta)
    Gene Symbols & Synonyms CXCL1,FSP,GRO1,GROa,MGSA,NAP-3,SCYB1,MGSA-a
    Target Alternative Names C-X-C motif chemokine 1,CXCL1,FSP,GRO-alpha(1-73),GRO1,GROa,Growth-regulated alpha protein,MGSA,MGSA-a,Melanoma growth stimulatory activity (MGSA),NAP-3,Neutrophil-activating protein 3 (NAP-3),SCYB1
    Uniprot Accession P09341
    Additional SwissProt Accessions: P09341
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, Cytokine Target
    Disease cancer, Prostate Cancer, Malignant neoplasm of bladder
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, NF-kappa B signaling pathway, NOD-like receptor signaling pathway, IL-17 signaling pathway, TNF signaling pathway, Alcoholic liver disease, Epithelial cell signaling in Helicobacter pylori infection, Legionellosis, Amoebiasis, Kaposi sarcoma-associated herpesvirus infection, Rheumatoid arthritis, Lipid and atherosclerosis
    Gene Ensembl ENSG00000163739, ENSMMUG00000008367
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.