Human NCR3/1C7/CD337 ORF/cDNA clone-Lentivirus plasmid (NM_147130)

Cat. No.: pGMLP000063
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NCR3/1C7/CD337 Lentiviral expression plasmid for NCR3 lentivirus packaging, NCR3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NCR3/NKp30/CD337/NCR3/1C7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $451.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000063
Gene Name NCR3
Accession Number NM_147130
Gene ID 259197
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 606 bp
Gene Alias 1C7,CD337,LY117,MALS,NKp30
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTGGATGCTGTTGCTCATCTTGATCATGGTCCATCCAGGATCCTGTGCTCTCTGGGTGTCCCAGCCCCCTGAGATTCGTACCCTGGAAGGATCCTCTGCCTTCCTGCCCTGCTCCTTCAATGCCAGCCAAGGGAGACTGGCCATTGGCTCCGTCACGTGGTTCCGAGATGAGGTGGTTCCAGGGAAGGAGGTGAGGAATGGAACCCCAGAGTTCAGGGGCCGCCTGGCCCCACTTGCTTCTTCCCGTTTCCTCCATGACCACCAGGCTGAGCTGCACATCCGGGACGTGCGAGGCCATGACGCCAGCATCTACGTGTGCAGAGTGGAGGTGCTGGGCCTTGGTGTCGGGACAGGGAATGGGACTCGGCTGGTGGTGGAGAAAGAACATCCTCAGCTAGGGGCTGGTACAGTCCTCCTCCTTCGGGCTGGATTCTATGCTGTCAGCTTTCTCTCTGTGGCCGTGGGCAGCACCGTCTATTACCAGGGCAAATGTCTGACCTGGAAAGGTCCAAGAAGGCAGCTGCCGGCTGTGGTCCCAGCGCCCCTCCCACCACCATGTGGGAGCTCAGCACATCTGCTTCCCCCAGTCCCAGGAGGCTGA
ORF Protein Sequence MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0869-Ab Anti-NCTR3/ NCR3/ 1C7 monoclonal antibody
    Target Antigen GM-Tg-g-MP0869-Ag NCR3 VLP (virus-like particle)
    ORF Viral Vector pGMLP000063 Human NCR3 Lentivirus plasmid
    ORF Viral Vector vGMLP000063 Human NCR3 Lentivirus particle


    Target information

    Target ID GM-MP0869
    Target Name NCR3/NKp30/CD337
    Gene Group Identifier
    （Target Gene ID in Homo species)         		259197
    Gene ID 100058447 (Equus caballus), 101100052 (Felis catus), 259197 (Homo sapiens), 294251 (Rattus norvegicus)
    513769 (Bos taurus), 607220 (Canis lupus familiaris), 715574 (Macaca mulatta)
    Gene Symbols & Synonyms NCR3,Ncr3,1C7,MALS,CD337,LY117,NKp30,Nkp30
    Target Alternative Names 1C7,Activating natural killer receptor p30,CD337,LY117,MALS,NCR3,NKp30,NKp30),Natural cytotoxicity triggering receptor 3,Natural killer cell p30-related protein (NK-p30,Ncr3,Nkp30
    Uniprot Accession O14931,Q8CFD9,Q8MJ02
    Additional SwissProt Accessions: O14931,Q8CFD9,Q8MJ02
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Natural killer cell mediated cytotoxicity
    Gene Ensembl ENSECAG00000051610, ENSG00000204475, ENSBTAG00000018343, ENSMMUG00000008854
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.