Human CCL28/CCK1/MEC ORF/cDNA clone-Lentivirus plasmid (NM_148672)

Cat. No.: pGMLP000149
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCL28/CCK1/MEC Lentiviral expression plasmid for CCL28 lentivirus packaging, CCL28 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCL28/CCK1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000149
Gene Name CCL28
Accession Number NM_148672
Gene ID 56477
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 384 bp
Gene Alias CCK1,MEC,SCYA28
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCAGAGAGGACTCGCCATCGTGGCCTTGGCTGTCTGTGCGGCCCTACATGCCTCAGAAGCCATACTTCCCATTGCCTCCAGCTGTTGCACGGAGGTTTCACATCATATTTCCAGAAGGCTCCTGGAAAGAGTGAATATGTGTCGCATCCAGAGAGCTGATGGGGATTGTGACTTGGCTGCTGTCATCCTTCATGTCAAGCGCAGAAGAATCTGTGTCAGCCCGCACAACCATACTGTTAAGCAGTGGATGAAAGTGCAAGCTGCCAAGAAAAATGGTAAAGGAAATGTTTGCCACAGGAAGAAACACCATGGCAAGAGGAACAGTAACAGGGCACATCAGGGGAAACACGAAACATACGGCCATAAAACTCCTTATTAG
ORF Protein Sequence MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0748-Ab Anti-CCL28/ CCK1/ MEC functional antibody
    Target Antigen GM-Tg-g-SE0748-Ag CCL28 protein
    Cytokine cks-Tg-g-GM-SE0748 chemokine (C-C motif) ligand 28 (CCL28) protein & antibody
    ORF Viral Vector pGMLP000149 Human CCL28 Lentivirus plasmid
    ORF Viral Vector vGMLP000149 Human CCL28 Lentivirus particle


    Target information

    Target ID GM-SE0748
    Target Name CCL28
    Gene Group Identifier
    （Target Gene ID in Homo species)         		56477
    Gene ID 100629419 (Equus caballus), 101091759 (Felis catus), 114492 (Rattus norvegicus), 448795 (Canis lupus familiaris)
    535328 (Bos taurus), 56477 (Homo sapiens), 56838 (Mus musculus), 574221 (Macaca mulatta)
    Gene Symbols & Synonyms CCL28,Ccl28,Scya28,MEC,CCK1,SCYA28
    Target Alternative Names C-C motif chemokine 28,CCK1,CCL28,Ccl28,MEC,Mucosae-associated epithelial chemokine (MEC),Protein CCK1,SCYA28,Scya28,Small-inducible cytokine A28
    Uniprot Accession Q68A91,Q9JIL2,Q9NRJ3
    Additional SwissProt Accessions: Q68A91,Q9NRJ3,Q9JIL2
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Breast Cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, Intestinal immune network for IgA production
    Gene Ensembl ENSECAG00000008624, ENSG00000151882, ENSMUSG00000074715, ENSMMUG00000000179
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.