Human FABP2/FABPI/I-FABP ORF/cDNA clone-Lentivirus plasmid (NM_000134)
Cat. No.: pGMLP000151
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FABP2/FABPI/I-FABP Lentiviral expression plasmid for FABP2 lentivirus packaging, FABP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
FABP2/FABPI products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000151 |
| Gene Name | FABP2 |
| Accession Number | NM_000134 |
| Gene ID | 2169 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 399 bp |
| Gene Alias | FABPI,I-FABP |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGTTTGACAGCACTTGGAAGGTAGACCGGAGTGAAAACTATGACAAGTTCATGGAAAAAATGGGTGTTAATATAGTGAAAAGGAAGCTTGCAGCTCATGACAATTTGAAGCTGACAATTACACAAGAAGGAAATAAATTCACAGTCAAAGAATCAAGCACTTTTCGAAACATTGAAGTTGTTTTTGAACTTGGTGTCACCTTTAATTACAATCTAGCAGACGGAACTGAACTCAGGGGGACCTGGAGCCTTGAGGGAAATAAACTTATTGGAAAATTCAAACGGACAGACAATGGAAACGAACTGAATACTGTCCGAGAAATTATAGGTGATGAACTAGTCCAGACTTATGTATATGAAGGAGTAGAAGCCAAAAGGATCTTTAAAAAGGATTGA |
| ORF Protein Sequence | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP2115-Ab | Anti-FABPI/ FABP2/ I-FABP monoclonal antibody |
| Target Antigen | GM-Tg-g-MP2115-Ag | FABP2 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000151 | Human FABP2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000151 | Human FABP2 Lentivirus particle |
Target information
| Target ID | GM-MP2115 |
| Target Name | FABP2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2169 |
| Gene ID |
100034050 (Equus caballus), 101093099 (Felis catus), 119867213 (Canis lupus familiaris), 14079 (Mus musculus) 2169 (Homo sapiens), 25598 (Rattus norvegicus), 515768 (Bos taurus), 705475 (Macaca mulatta) |
| Gene Symbols & Synonyms | FABP2,Fabp2,I-FABP,Fabpi,FABPI,FABP |
| Target Alternative Names | FABP,FABP2,FABPI,Fabp2,Fabpi,Fatty acid-binding protein,Fatty acid-binding protein 2,I-FABP,Intestinal-type fatty acid-binding protein (I-FABP),intestinal |
| Uniprot Accession |
P02693,P12104,P55050,Q56JX9
Additional SwissProt Accessions: P55050,P12104,P02693,Q56JX9 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | Perinatal necrotizing enterocolitis, Other diseases of intestines (K55-K64) |
| Disease from KEGG | PPAR signaling pathway, Fat digestion and absorption |
| Gene Ensembl | ENSECAG00000016345, ENSCAFG00845030144, ENSMUSG00000023057, ENSG00000145384, ENSMMUG00000061216 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


