Human FABP2/FABPI/I-FABP ORF/cDNA clone-Lentivirus plasmid (NM_000134)

Cat. No.: pGMLP000151
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FABP2/FABPI/I-FABP Lentiviral expression plasmid for FABP2 lentivirus packaging, FABP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FABP2/FABPI products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000151
Gene Name FABP2
Accession Number NM_000134
Gene ID 2169
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 399 bp
Gene Alias FABPI,I-FABP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTTTGACAGCACTTGGAAGGTAGACCGGAGTGAAAACTATGACAAGTTCATGGAAAAAATGGGTGTTAATATAGTGAAAAGGAAGCTTGCAGCTCATGACAATTTGAAGCTGACAATTACACAAGAAGGAAATAAATTCACAGTCAAAGAATCAAGCACTTTTCGAAACATTGAAGTTGTTTTTGAACTTGGTGTCACCTTTAATTACAATCTAGCAGACGGAACTGAACTCAGGGGGACCTGGAGCCTTGAGGGAAATAAACTTATTGGAAAATTCAAACGGACAGACAATGGAAACGAACTGAATACTGTCCGAGAAATTATAGGTGATGAACTAGTCCAGACTTATGTATATGAAGGAGTAGAAGCCAAAAGGATCTTTAAAAAGGATTGA
ORF Protein Sequence MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2115-Ab Anti-FABPI/ FABP2/ I-FABP monoclonal antibody
    Target Antigen GM-Tg-g-MP2115-Ag FABP2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000151 Human FABP2 Lentivirus plasmid
    ORF Viral Vector vGMLP000151 Human FABP2 Lentivirus particle


    Target information

    Target ID GM-MP2115
    Target Name FABP2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2169
    Gene ID 100034050 (Equus caballus), 101093099 (Felis catus), 119867213 (Canis lupus familiaris), 14079 (Mus musculus)
    2169 (Homo sapiens), 25598 (Rattus norvegicus), 515768 (Bos taurus), 705475 (Macaca mulatta)
    Gene Symbols & Synonyms FABP2,Fabp2,I-FABP,Fabpi,FABPI,FABP
    Target Alternative Names FABP,FABP2,FABPI,Fabp2,Fabpi,Fatty acid-binding protein,Fatty acid-binding protein 2,I-FABP,Intestinal-type fatty acid-binding protein (I-FABP),intestinal
    Uniprot Accession P02693,P12104,P55050,Q56JX9
    Additional SwissProt Accessions: P55050,P12104,P02693,Q56JX9
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease Perinatal necrotizing enterocolitis, Other diseases of intestines (K55-K64)
    Disease from KEGG PPAR signaling pathway, Fat digestion and absorption
    Gene Ensembl ENSECAG00000016345, ENSCAFG00845030144, ENSMUSG00000023057, ENSG00000145384, ENSMMUG00000061216
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.