Human IL23A/IL-23/IL-23A ORF/cDNA clone-Lentivirus plasmid (NM_016584)
Cat. No.: pGMLP000160
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL23A/IL-23/IL-23A Lentiviral expression plasmid for IL23A lentivirus packaging, IL23A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IL-23 p19/NeutraControl IL-23 p19/IL23A/IL23/IL23A/IL-23 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000160 |
| Gene Name | IL23A |
| Accession Number | NM_016584 |
| Gene ID | 51561 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 570 bp |
| Gene Alias | IL-23,IL-23A,IL23P19,P19,SGRF |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCTGGGGAGCAGAGCTGTAATGCTGCTGTTGCTGCTGCCCTGGACAGCTCAGGGCAGAGCTGTGCCTGGGGGCAGCAGCCCTGCCTGGACTCAGTGCCAGCAGCTTTCACAGAAGCTCTGCACACTGGCCTGGAGTGCACATCCACTAGTGGGACACATGGATCTAAGAGAAGAGGGAGATGAAGAGACTACAAATGATGTTCCCCATATCCAGTGTGGAGATGGCTGTGACCCCCAAGGACTCAGGGACAACAGTCAGTTCTGCTTGCAAAGGATCCACCAGGGTCTGATTTTTTATGAGAAGCTGCTAGGATCGGATATTTTCACAGGGGAGCCTTCTCTGCTCCCTGATAGCCCTGTGGGCCAGCTTCATGCCTCCCTACTGGGCCTCAGCCAACTCCTGCAGCCTGAGGGTCACCACTGGGAGACTCAGCAGATTCCAAGCCTCAGTCCCAGCCAGCCATGGCAGCGTCTCCTTCTCCGCTTCAAAATCCTTCGCAGCCTCCAGGCCTTTGTGGCTGTAGCCGCCCGGGTCTTTGCCCATGGAGCAGCAACCCTGAGTCCCTAA |
| ORF Protein Sequence | MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T06841 |
| Target Name | IL-23 p19/NeutraControl IL-23 p19/IL23A/IL23 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
51561 |
| Gene ID |
100034230 (Equus caballus), 155140 (Rattus norvegicus), 481110 (Canis lupus familiaris), 511022 (Bos taurus) 51561 (Homo sapiens), 654423 (Felis catus), 712627 (Macaca mulatta), 83430 (Mus musculus) |
| Gene Symbols & Synonyms | IL23A,Il23a,IL23,IL-23,P19,SGRF,IL-23A,IL23P19,p19 |
| Target Alternative Names | IL-23,IL-23 p19,IL-23 subunit alpha,IL-23-A,IL-23A,IL23,IL23A,IL23P19,Il23a,Interleukin-23 subunit alpha,Interleukin-23 subunit p19 (IL-23p19),NeutraControl IL-23 p19,P19,SGRF,p19 |
| Uniprot Accession |
Q64FU1,Q91Z84,Q9EQ14,Q9NPF7
Additional SwissProt Accessions: Q64FU1,Q91Z84,Q9NPF7,Q9EQ14 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, INN Index, Cytokine Target |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction, C-type lectin receptor signaling pathway, JAK-STAT signaling pathway, Th17 cell differentiation, Pertussis, Tuberculosis, Pathways in cancer, Inflammatory bowel disease, Rheumatoid arthritis |
| Gene Ensembl | ENSCAFG00845008036, ENSBTAG00000004378, ENSG00000110944, ENSMMUG00000031831, ENSMUSG00000025383 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


