Human IL23A/IL-23/IL-23A ORF/cDNA clone-Lentivirus plasmid (NM_016584)

Cat. No.: pGMLP000160
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL23A/IL-23/IL-23A Lentiviral expression plasmid for IL23A lentivirus packaging, IL23A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-23 p19/NeutraControl IL-23 p19/IL23A/IL23/IL23A/IL-23 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $442.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000160
Gene Name IL23A
Accession Number NM_016584
Gene ID 51561
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 570 bp
Gene Alias IL-23,IL-23A,IL23P19,P19,SGRF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGGGGAGCAGAGCTGTAATGCTGCTGTTGCTGCTGCCCTGGACAGCTCAGGGCAGAGCTGTGCCTGGGGGCAGCAGCCCTGCCTGGACTCAGTGCCAGCAGCTTTCACAGAAGCTCTGCACACTGGCCTGGAGTGCACATCCACTAGTGGGACACATGGATCTAAGAGAAGAGGGAGATGAAGAGACTACAAATGATGTTCCCCATATCCAGTGTGGAGATGGCTGTGACCCCCAAGGACTCAGGGACAACAGTCAGTTCTGCTTGCAAAGGATCCACCAGGGTCTGATTTTTTATGAGAAGCTGCTAGGATCGGATATTTTCACAGGGGAGCCTTCTCTGCTCCCTGATAGCCCTGTGGGCCAGCTTCATGCCTCCCTACTGGGCCTCAGCCAACTCCTGCAGCCTGAGGGTCACCACTGGGAGACTCAGCAGATTCCAAGCCTCAGTCCCAGCCAGCCATGGCAGCGTCTCCTTCTCCGCTTCAAAATCCTTCGCAGCCTCCAGGCCTTTGTGGCTGTAGCCGCCCGGGTCTTTGCCCATGGAGCAGCAACCCTGAGTCCCTAA
ORF Protein Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-573 Pre-Made Tildrakizumab biosimilar, Whole mAb, Anti-IL23A/IL23 Antibody: Anti-IL23P19/P19/SGRF therapeutic antibody
    Biosimilar GMP-Bios-ab-347 Pre-Made Mirikizumab biosimilar, Whole mAb, Anti-IL23A/IL23 Antibody: Anti-IL23P19/P19/SGRF therapeutic antibody
    Biosimilar GMP-Bios-ab-079 Pre-Made Brazikumab biosimilar, Whole mAb, Anti-IL23A/IL23 Antibody: Anti-IL23P19/P19/SGRF therapeutic antibody
    Biosimilar GMP-Bios-ab-486 Pre-Made Risankizumab biosimilar, Whole mAb, Anti-IL23A/IL23 Antibody: Anti-IL23P19/P19/SGRF therapeutic antibody
    Biosimilar GMP-Bios-ab-255 Pre-Made Guselkumab biosimilar, Whole mAb, Anti-IL23A/IL23 Antibody: Anti-IL23P19/P19/SGRF therapeutic antibody
    Target Antibody GM-Tg-g-T06841-Ab Anti-IL23A/ IL23/ IL-23 functional antibody
    Target Antigen GM-Tg-g-T06841-Ag IL23/IL23A protein
    Cytokine cks-Tg-g-GM-T06841 Interleukin 23, alpha subunit p19 (IL23A) protein & antibody
    ORF Viral Vector pGMLP000160 Human IL23A Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-030 Human IL23A Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-113 Human IL23A Adenovirus plasmid
    ORF Viral Vector vGMLP000160 Human IL23A Lentivirus particle
    ORF Viral Vector vGMLP-IL-030 Human IL23A Lentivirus particle
    ORF Viral Vector vGMAP-IL-113 Human IL23A Adenovirus particle


    Target information

    Target ID GM-T06841
    Target Name IL-23 p19/NeutraControl IL-23 p19/IL23A/IL23
    Gene Group Identifier
    （Target Gene ID in Homo species)         		51561
    Gene ID 100034230 (Equus caballus), 155140 (Rattus norvegicus), 481110 (Canis lupus familiaris), 511022 (Bos taurus)
    51561 (Homo sapiens), 654423 (Felis catus), 712627 (Macaca mulatta), 83430 (Mus musculus)
    Gene Symbols & Synonyms IL23A,Il23a,IL23,IL-23,P19,SGRF,IL-23A,IL23P19,p19
    Target Alternative Names IL-23,IL-23 p19,IL-23 subunit alpha,IL-23-A,IL-23A,IL23,IL23A,IL23P19,Il23a,Interleukin-23 subunit alpha,Interleukin-23 subunit p19 (IL-23p19),NeutraControl IL-23 p19,P19,SGRF,p19
    Uniprot Accession Q64FU1,Q91Z84,Q9EQ14,Q9NPF7
    Additional SwissProt Accessions: Q64FU1,Q91Z84,Q9NPF7,Q9EQ14
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, C-type lectin receptor signaling pathway, JAK-STAT signaling pathway, Th17 cell differentiation, Pertussis, Tuberculosis, Pathways in cancer, Inflammatory bowel disease, Rheumatoid arthritis
    Gene Ensembl ENSCAFG00845008036, ENSBTAG00000004378, ENSG00000110944, ENSMMUG00000031831, ENSMUSG00000025383
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.