Human GNG2 ORF/cDNA clone-Lentivirus plasmid (NM_053064)
Cat. No.: pGMLP000165
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human GNG2/ Lentiviral expression plasmid for GNG2 lentivirus packaging, GNG2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
GNG2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000165 |
| Gene Name | GNG2 |
| Accession Number | NM_053064 |
| Gene ID | 54331 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 216 bp |
| Gene Alias | |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCAGCAACAACACCGCCAGCATAGCACAAGCCAGGAAGCTGGTAGAGCAGCTTAAGATGGAAGCCAATATCGACAGGATAAAGGTGTCCAAGGCAGCTGCAGATTTGATGGCCTACTGTGAAGCACATGCCAAGGAAGACCCCCTCCTGACCCCTGTTCCGGCTTCAGAAAACCCGTTTAGGGAGAAGAAGTTTTTCTGTGCCATCCTTTAA |
| ORF Protein Sequence | MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP2148-Ab | Anti-GBG2/ GNG2 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP2148-Ag | GNG2 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000165 | Human GNG2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000165 | Human GNG2 Lentivirus particle |
Target information
| Target ID | GM-MP2148 |
| Target Name | GNG2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
54331 |
| Gene ID |
100630067 (Equus caballus), 101097491 (Felis catus), 14702 (Mus musculus), 281203 (Bos taurus) 54331 (Homo sapiens), 610817 (Canis lupus familiaris), 710000 (Macaca mulatta), 80850 (Rattus norvegicus) |
| Gene Symbols & Synonyms | GNG2,Gng2,HG3F1,Hg3f1 |
| Target Alternative Names | G gamma-I,GNG2,Gng2,Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2,HG3F1,Hg3f1 |
| Uniprot Accession |
P59768,P63212,P63213
Additional SwissProt Accessions: P63213,P63212,P59768 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | |
| Disease from KEGG | Ras signaling pathway, Chemokine signaling pathway, PI3K-Akt signaling pathway, Circadian entrainment, Glutamatergic synapse, Cholinergic synapse, Serotonergic synapse, GABAergic synapse, Relaxin signaling pathway, Morphine addiction, Human cytomegalovirus infection, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer |
| Gene Ensembl | ENSMUSG00000043004, ENSBTAG00000003043, ENSG00000186469 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


