Human GNG2 ORF/cDNA clone-Lentivirus plasmid (NM_053064)

Cat. No.: pGMLP000165
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GNG2/ Lentiviral expression plasmid for GNG2 lentivirus packaging, GNG2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GNG2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000165
Gene Name GNG2
Accession Number NM_053064
Gene ID 54331
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 216 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCAGCAACAACACCGCCAGCATAGCACAAGCCAGGAAGCTGGTAGAGCAGCTTAAGATGGAAGCCAATATCGACAGGATAAAGGTGTCCAAGGCAGCTGCAGATTTGATGGCCTACTGTGAAGCACATGCCAAGGAAGACCCCCTCCTGACCCCTGTTCCGGCTTCAGAAAACCCGTTTAGGGAGAAGAAGTTTTTCTGTGCCATCCTTTAA
ORF Protein Sequence MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2148-Ab Anti-GBG2/ GNG2 monoclonal antibody
    Target Antigen GM-Tg-g-MP2148-Ag GNG2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000165 Human GNG2 Lentivirus plasmid
    ORF Viral Vector vGMLP000165 Human GNG2 Lentivirus particle


    Target information

    Target ID GM-MP2148
    Target Name GNG2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		54331
    Gene ID 100630067 (Equus caballus), 101097491 (Felis catus), 14702 (Mus musculus), 281203 (Bos taurus)
    54331 (Homo sapiens), 610817 (Canis lupus familiaris), 710000 (Macaca mulatta), 80850 (Rattus norvegicus)
    Gene Symbols & Synonyms GNG2,Gng2,HG3F1,Hg3f1
    Target Alternative Names G gamma-I,GNG2,Gng2,Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2,HG3F1,Hg3f1
    Uniprot Accession P59768,P63212,P63213
    Additional SwissProt Accessions: P63213,P63212,P59768
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Ras signaling pathway, Chemokine signaling pathway, PI3K-Akt signaling pathway, Circadian entrainment, Glutamatergic synapse, Cholinergic synapse, Serotonergic synapse, GABAergic synapse, Relaxin signaling pathway, Morphine addiction, Human cytomegalovirus infection, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer
    Gene Ensembl ENSMUSG00000043004, ENSBTAG00000003043, ENSG00000186469
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.