Human ATOX1/ATX1/HAH1 ORF/cDNA clone-Lentivirus plasmid (NM_004045)

Cat. No.: pGMLP000187
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ATOX1/ATX1/HAH1 Lentiviral expression plasmid for ATOX1 lentivirus packaging, ATOX1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ATOX1/ATX1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000187
Gene Name ATOX1
Accession Number NM_004045
Gene ID 475
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 207 bp
Gene Alias ATX1,HAH1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCGAAGCACGAGTTCTCTGTGGACATGACCTGTGGAGGCTGTGCTGAAGCTGTCTCTCGGGTCCTCAATAAGCTTGGAGGAGTTAAGTATGACATTGACCTGCCCAACAAGAAGGTCTGCATTGAATCTGAGCACAGCATGGACACTCTGCTTGCAACCCTGAAGAAAACAGGAAAGACTGTTTCCTACCTTGGCCTTGAGTAG
ORF Protein Sequence MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2366-Ab Anti-ATOX1 monoclonal antibody
    Target Antigen GM-Tg-g-IP2366-Ag ATOX1 protein
    ORF Viral Vector pGMLP000187 Human ATOX1 Lentivirus plasmid
    ORF Viral Vector vGMLP000187 Human ATOX1 Lentivirus particle


    Target information

    Target ID GM-IP2366
    Target Name ATOX1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		475
    Gene ID 100071499 (Equus caballus), 101084170 (Felis catus), 11927 (Mus musculus), 403713 (Canis lupus familiaris)
    475 (Homo sapiens), 613998 (Bos taurus), 712464 (Macaca mulatta), 84355 (Rattus norvegicus)
    Gene Symbols & Synonyms ATOX1,Atox1,Atx1,ATX1,HAH1
    Target Alternative Names ATOX1,ATX1,Atox1,Atx1,Copper transport protein ATOX1,HAH1,Metal transport protein ATX1
    Uniprot Accession O00244,O08997,Q3T0E0,Q9TT99,Q9WUC4
    Additional SwissProt Accessions: O08997,Q9TT99,O00244,Q3T0E0,Q9WUC4
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG Mineral absorption
    Gene Ensembl ENSMUSG00000018585, ENSCAFG00845005141, ENSG00000177556, ENSBTAG00000008340, ENSMMUG00000054302
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.