Human CD8B/CD8B1/LEU2 ORF/cDNA clone-Lentivirus plasmid (NM_172213.3)

Cat. No.: pGMLP000202
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD8B/CD8B1/LEU2 Lentiviral expression plasmid for CD8B lentivirus packaging, CD8B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CD8b/CD8B/CD8B/CD8B1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $483
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000202
Gene Name CD8B
Accession Number NM_172213.3
Gene ID 926
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 732 bp
Gene Alias CD8B1,LEU2,LY3,LYT3,P37
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGGCCGCGGCTGTGGCTCCTCTTGGCCGCGCAGCTGACAGTTCTCCATGGCAACTCAGTCCTCCAGCAGACCCCTGCATACATAAAGGTGCAAACCAACAAGATGGTGATGCTGTCCTGCGAGGCTAAAATCTCCCTCAGTAACATGCGCATCTACTGGCTGAGACAGCGCCAGGCACCGAGCAGTGACAGTCACCACGAGTTCCTGGCCCTCTGGGATTCCGCAAAAGGGACTATCCACGGTGAAGAGGTGGAACAGGAGAAGATAGCTGTGTTTCGGGATGCAAGCCGGTTCATTCTCAATCTCACAAGCGTGAAGCCGGAAGACAGTGGCATCTACTTCTGCATGATCGTCGGGAGCCCCGAGCTGACCTTCGGGAAGGGAACTCAGCTGAGTGTGGTTGATTTCCTTCCCACCACTGCCCAGCCCACCAAGAAGTCCACCCTCAAGAAGAGAGTGTGCCGGTTACCCAGGCCAGAGACCCAGAAGGGCCCACTTTGTAGCCCCATCACCCTTGGCCTGCTGGTGGCTGGCGTCCTGGTTCTGCTGGTTTCCCTGGGAGTGGCCATCCACCTGTGCTGCCGGCGGAGGAGAGCCCGGCTTCGTTTCATGAAACAGCCTCAAGGGGAAGGTATATCAGGAACCTTTGTCCCCCAATGCCTGCATGGATACTACAGCAATACTACAACCTCACAGAAGCTGCTTAACCCATGGATCCTGAAAACATAG
ORF Protein Sequence MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA107-Ab Anti-CD8B/ CD8B1/ LEU2 monoclonal antibody
    Target Antigen GM-Tg-g-TA107-Ag CD8B VLP (virus-like particle)
    ORF Viral Vector pGMLP000202 Human CD8B Lentivirus plasmid
    ORF Viral Vector vGMLP000202 Human CD8B Lentivirus particle


    Target information

    Target ID GM-TA107
    Target Name CD8b/CD8B
    Gene Group Identifier
    （Target Gene ID in Homo species)         		926
    Gene ID 100052855 (Equus caballus), 12526 (Mus musculus), 24931 (Rattus norvegicus), 483076 (Canis lupus familiaris)
    493948 (Felis catus), 508633 (Bos taurus), 699409 (Macaca mulatta), 926 (Homo sapiens)
    Gene Symbols & Synonyms CD8B,Cd8b1,Cd8b,Ly-3,Ly-C,Lyt-3,LY3,P37,LEU2,LYT3,CD8B1,CD8beta
    Target Alternative Names CD8B,CD8B1,CD8b,CD8beta,Cd8b,Cd8b1,LEU2,LY3,LYT3,Ly-3,Ly-C,Lyt-3,P37,T-cell surface glycoprotein CD8 beta chain
    Uniprot Accession P05541,P10300,P10966,P79336
    Additional SwissProt Accessions: P10300,P05541,P79336,P10966
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Cell adhesion molecules, Antigen processing and presentation, Hematopoietic cell lineage, T cell receptor signaling pathway, Yersinia infection
    Gene Ensembl ENSECAG00000000775, ENSMUSG00000053044, ENSCAFG00845013126, ENSBTAG00000008956, ENSMMUG00000003532, ENSG00000172116
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.