Human CRIP1/CRHP/CRIP ORF/cDNA clone-Lentivirus plasmid (NM_001311)

Cat. No.: pGMLP000219
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CRIP1/CRHP/CRIP Lentiviral expression plasmid for CRIP1 lentivirus packaging, CRIP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CRIP1/CRHP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000219
Gene Name CRIP1
Accession Number NM_001311
Gene ID 1396
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 234 bp
Gene Alias CRHP,CRIP,CRP-1,CRP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCCAAGTGTCCCAAGTGCAACAAGGAGGTGTACTTCGCCGAGAGGGTGACCTCTCTGGGCAAGGACTGGCATCGGCCCTGCCTGAAGTGCGAGAAATGTGGGAAGACGCTGACCTCTGGGGGCCACGCTGAGCACGAAGGCAAACCCTACTGCAACCACCCCTGCTACGCAGCCATGTTTGGGCCTAAAGGCTTTGGGCGGGGCGGAGCCGAGAGCCACACTTTCAAGTAA
ORF Protein Sequence MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2437-Ab Anti-CRIP1 monoclonal antibody
    Target Antigen GM-Tg-g-IP2437-Ag CRIP1 protein
    ORF Viral Vector pGMLP000219 Human CRIP1 Lentivirus plasmid
    ORF Viral Vector vGMLP000219 Human CRIP1 Lentivirus particle


    Target information

    Target ID GM-IP2437
    Target Name CRIP1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1396
    Gene ID 100630592 (Equus caballus), 101101478 (Felis catus), 12925 (Mus musculus), 1396 (Homo sapiens)
    574093 (Bos taurus), 612713 (Canis lupus familiaris), 691657 (Rattus norvegicus), 699632 (Macaca mulatta)
    Gene Symbols & Synonyms CRIP1,Crip1,CRHP,CRP1,Crip,CRIP,CRP-1,Crp-1
    Target Alternative Names CRHP,CRIP,CRIP1,CRP-1,CRP1,Crip,Crip1,Crp-1,Cysteine-rich heart protein (CRHP,Cysteine-rich intestinal protein (CRIP),Cysteine-rich protein 1,hCRHP)
    Uniprot Accession P50238,P63254,P63255,Q56K04
    Additional SwissProt Accessions: P63254,P50238,Q56K04,P63255
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease Ovary Cancer
    Disease from KEGG
    Gene Ensembl ENSMUSG00000006360, ENSG00000213145, ENSCAFG00845024912, ENSMMUG00000056589
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.