Human BCL2L12 ORF/cDNA clone-Lentivirus plasmid (NM_138639)

Cat. No.: pGMLP000231
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BCL2L12/ Lentiviral expression plasmid for BCL2L12 lentivirus packaging, BCL2L12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to BCL2L12 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $581.4
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000231
Gene Name BCL2L12
Accession Number NM_138639
Gene ID 83596
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1005 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGGCTCTGAAGAGCTGGGGCTCCGGGAAGACACGCTGAGGGTCCTAGCTGCCTTCCTTAGGCGTGGTGAGGCTGCCGGGTCTCCTGTTCCAACTCCACCTAGAAGCCCTGCCCAAGAAGAGCCAACAGACTTCCTGAGCCGCCTTCGAAGATGTCTTCCCTGCTCCCTGGGGCGAGGAGCAGCCCCCTCTGAGTCCCCTCGGCCTTGCTCTCTGCCCATCCGCCCCTGCTATGGTTTAGAGCCTGGCCCAGCTACTCCAGACTTCTATGCTTTGGTGGCCCAGCGGCTGGAACAGCTGGTCCAAGAGCAGCTGAAATCTCCGCCCAGCCCAGAATTACAGGGTCCCCCATCGACAGAGAAGGAAGCCATACTGCGGAGGCTGGTGGCCCTGCTGGAGGAGGAGGCAGAAGTCATTAACCAGAAGCTGGCCTCGGACCCCGCCCTGCGCAGCAAGCTGGTCCGCCTGTCCTCCGACTCTTTCGCCCGCCTGGTGGAGCTGTTCTGTAGCCGGGATGACAGCTCTCGCCCAAGCCGAGCATGCCCCGGGCCCCCGCCTCCTTCCCCGGAGCCCCTGGCCCGCCTGGCCCTAGCCATGGAGCTGAGCCGGCGCGTGGCCGGGCTGGGGGGCACCCTGGCCGGACTCAGCGTGGAGCACGTGCACAGCTTCACGCCCTGGATCCAGGCCCACGGGGGCTGGGAGGGCATCCTGGCTGTTTCACCCGTGGACTTGAACTTGCCATTGGACTGA
ORF Protein Sequence MAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPRSPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2373-Ab Anti-BCL2L12 monoclonal antibody
    Target Antigen GM-Tg-g-IP2373-Ag BCL2L12 protein
    ORF Viral Vector pGMLP000231 Human BCL2L12 Lentivirus plasmid
    ORF Viral Vector vGMLP000231 Human BCL2L12 Lentivirus particle


    Target information

    Target ID GM-IP2373
    Target Name BCL2L12
    Gene Group Identifier
    (Target Gene ID in Homo species)
    83596
    Gene ID 100055909 (Equus caballus), 100688537 (Canis lupus familiaris), 101080498 (Felis catus), 361567 (Rattus norvegicus)
    533338 (Bos taurus), 718981 (Macaca mulatta), 75736 (Mus musculus), 83596 (Homo sapiens)
    Gene Symbols & Synonyms BCL2L12,Bcl2l12,Bcl-L12,Bcl2-L12,2810475P17Rik,5430429M05Rik
    Target Alternative Names 2810475P17Rik,5430429M05Rik,BCL2L12,Bcl-2-like protein 12,Bcl-2-related proline-rich protein,Bcl-L12,Bcl2-L-12,Bcl2-L12,Bcl2l12
    Uniprot Accession Q9HB09
    Additional SwissProt Accessions: Q9HB09
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000022614, ENSCAFG00845023183, ENSBTAG00000006638, ENSMMUG00000003926, ENSMUSG00000003190, ENSG00000126453
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.