Human G6PC/G6Pase/G6PC1 ORF/cDNA clone-Lentivirus plasmid (NM_000151)

Cat. No.: pGMLP000261
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human G6PC/G6Pase/G6PC1 Lentiviral expression plasmid for G6PC lentivirus packaging, G6PC lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to G6PC/G6PC1/G6PC/G6Pase products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $600.72
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000261
Gene Name G6PC
Accession Number NM_000151
Gene ID 2538
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1074 bp
Gene Alias G6Pase,G6PC1,G6PT,GSD1,GSD1a
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGAAGGAATGAATGTTCTCCATGACTTTGGGATCCAGTCAACACATTACCTCCAGGTGAATTACCAAGACTCCCAGGACTGGTTCATCTTGGTGTCCGTGATCGCAGACCTCAGGAATGCCTTCTACGTCCTCTTCCCCATCTGGTTCCATCTTCAGGAAGCTGTGGGCATTAAACTCCTTTGGGTAGCTGTGATTGGAGACTGGCTCAACCTCGTCTTTAAGTGGATTCTCTTTGGACAGCGTCCATACTGGTGGGTTTTGGATACTGACTACTACAGCAACACTTCCGTGCCCCTGATAAAGCAGTTCCCTGTAACCTGTGAGACTGGACCAGGGAGCCCCTCTGGCCATGCCATGGGCACAGCAGGTGTATACTACGTGATGGTCACATCTACTCTTTCCATCTTTCAGGGAAAGATAAAGCCGACCTACAGATTTCGGTGCTTGAATGTCATTTTGTGGTTGGGATTCTGGGCTGTGCAGCTGAATGTCTGTCTGTCACGAATCTACCTTGCTGCTCATTTTCCTCATCAAGTTGTTGCTGGAGTCCTGTCAGGCATTGCTGTTGCAGAAACTTTCAGCCACATCCACAGCATCTATAATGCCAGCCTCAAGAAATATTTTCTCATTACCTTCTTCCTGTTCAGCTTCGCCATCGGATTTTATCTGCTGCTCAAGGGACTGGGTGTAGACCTCCTGTGGACTCTGGAGAAAGCCCAGAGGTGGTGCGAGCAGCCAGAATGGGTCCACATTGACACCACACCCTTTGCCAGCCTCCTCAAGAACCTGGGCACGCTCTTTGGCCTGGGGCTGGCTCTCAACTCCAGCATGTACAGGGAGAGCTGCAAGGGGAAACTCAGCAAGTGGCTCCCATTCCGCCTCAGCTCTATTGTAGCCTCCCTCGTCCTCCTGCACGTCTTTGACTCCTTGAAACCCCCATCCCAAGTCGAGCTGGTCTTCTACGTCTTGTCCTTCTGCAAGAGTGCGGTAGTGCCCCTGGCATCCGTCAGTGTCATCCCCTACTGCCTCGCCCAGGTCCTGGGCCAGCCGCACAAGAAGTCGTTGTAA
ORF Protein Sequence MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0145-Ab Anti-G6PC monoclonal antibody
    Target Antigen GM-Tg-g-IP0145-Ag G6PC protein
    ORF Viral Vector pGMLP000261 Human G6PC Lentivirus plasmid
    ORF Viral Vector vGMLP000261 Human G6PC Lentivirus particle


    Target information

    Target ID GM-IP0145
    Target Name G6PC/G6PC1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2538
    Gene ID 100052233 (Equus caballus), 14377 (Mus musculus), 2538 (Homo sapiens), 25634 (Rattus norvegicus)
    403492 (Canis lupus familiaris), 538710 (Bos taurus), 712053 (Macaca mulatta), 723970 (Felis catus)
    Gene Symbols & Synonyms G6PC1,G6pc1,G6PC,G6pc,G6pt,G6Pase,Glc-6-Pase,G6PT,GSD1,GSD1a,Psme3,G-6-Pase
    Target Alternative Names G-6-Pase,G6PC,G6PC1,G6PT,G6Pase,G6Pase),G6pc,G6pc1,G6pt,GSD1,GSD1a,Glc-6-Pase,Glucose-6-phosphatase (G-6-Pase,Glucose-6-phosphatase alpha (G6Pase-alpha),Glucose-6-phosphatase catalytic subunit 1,Psme3
    Uniprot Accession O19133,P35575,P35576,P43428,Q19KA1,Q29RU6
    Additional SwissProt Accessions: P35576,P35575,P43428,O19133,Q29RU6,Q19KA1
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Metabolic pathways, FoxO signaling pathway, PI3K-Akt signaling pathway, Adipocytokine signaling pathway, Insulin resistance, Carbohydrate digestion and absorption
    Gene Ensembl ENSECAG00000000509, ENSMUSG00000078650, ENSG00000131482, ENSCAFG00845006712, ENSBTAG00000010184, ENSMMUG00000008087
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.