Human PLN/CMD1P/CMH18 ORF/cDNA clone-Lentivirus plasmid (NM_002667)

Cat. No.: pGMLP000281
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PLN/CMD1P/CMH18 Lentiviral expression plasmid for PLN lentivirus packaging, PLN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PLN/CMD1P products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000281
Gene Name PLN
Accession Number NM_002667
Gene ID 5350
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 159 bp
Gene Alias CMD1P,CMH18,PLB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGAAAGTCCAATACCTCACTCGCTCAGCTATAAGAAGAGCCTCAACCATTGAAATGCCTCAACAAGCACGTCAAAAGCTACAGAATCTATTTATCAATTTCTGTCTCATCTTAATATGTCTCTTGCTGATCTGTATCATCGTGATGCTTCTCTGA
ORF Protein Sequence MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0178-Ab Anti-PLN monoclonal antibody
    Target Antigen GM-Tg-g-IP0178-Ag PLN protein
    ORF Viral Vector pGMLP000281 Human PLN Lentivirus plasmid
    ORF Viral Vector vGMLP000281 Human PLN Lentivirus particle


    Target information

    Target ID GM-IP0178
    Target Name PLN
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5350
    Gene ID 100125240 (Bos taurus), 100426104 (Macaca mulatta), 100630668 (Equus caballus), 101097897 (Felis catus)
    18821 (Mus musculus), 414755 (Canis lupus familiaris), 5350 (Homo sapiens), 64672 (Rattus norvegicus)
    Gene Symbols & Synonyms PLN,Pln,PLB,Plb,CMD1P,CMH18,Plm
    Target Alternative Names CMD1P,CMH18,PLB,PLN,Phospholamban,Plb,Plm,Pln
    Uniprot Accession A4IFH6,P26678,P61012,P61014,P61016
    Additional SwissProt Accessions: A4IFH6,P61014,P61012,P26678,P61016
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Prostate Cancer
    Disease from KEGG Calcium signaling pathway, cGMP-PKG signaling pathway, cAMP signaling pathway, Adrenergic signaling in cardiomyocytes, Thyroid hormone signaling pathway, Dilated cardiomyopathy
    Gene Ensembl ENSBTAG00000012931, ENSECAG00000036379, ENSMUSG00000038583, ENSCAFG00845007035, ENSG00000198523
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.