Human S100A4/18A2/42A ORF/cDNA clone-Lentivirus plasmid (NM_002961)

Cat. No.: pGMLP000284
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human S100A4/18A2/42A Lentiviral expression plasmid for S100A4 lentivirus packaging, S100A4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FSP1/S100A4/S100A4/18A2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000284
Gene Name S100A4
Accession Number NM_002961
Gene ID 6275
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 306 bp
Gene Alias 18A2,42A,CAPL,FSP1,MTS1,P9KA,PEL98
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTGCCCTCTGGAGAAGGCCCTGGATGTGATGGTGTCCACCTTCCACAAGTACTCGGGCAAAGAGGGTGACAAGTTCAAGCTCAACAAGTCAGAACTAAAGGAGCTGCTGACCCGGGAGCTGCCCAGCTTCTTGGGGAAAAGGACAGATGAAGCTGCTTTCCAGAAGCTGATGAGCAACTTGGACAGCAACAGGGACAACGAGGTGGACTTCCAAGAGTACTGTGTCTTCCTGTCCTGCATCGCCATGATGTGTAACGAATTCTTTGAAGGCTTCCCAGATAAGCAGCCCAGGAAGAAATGA
ORF Protein Sequence MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T35265-Ab Anti-S10A4/ S100A4/ 18A2 functional antibody
    Target Antigen GM-Tg-g-T35265-Ag S100A4 protein
    ORF Viral Vector pGMLP000284 Human S100A4 Lentivirus plasmid
    ORF Viral Vector pGMLV000591 Human S100A4 Lentivirus plasmid
    ORF Viral Vector pGMLV001466 Human S100A4 Lentivirus plasmid
    ORF Viral Vector vGMLP000284 Human S100A4 Lentivirus particle
    ORF Viral Vector vGMLV000591 Human S100A4 Lentivirus particle
    ORF Viral Vector vGMLV001466 Human S100A4 Lentivirus particle


    Target information

    Target ID GM-T35265
    Target Name FSP1/S100A4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6275
    Gene ID 100056181 (Equus caballus), 101083141 (Felis catus), 20198 (Mus musculus), 24615 (Rattus norvegicus)
    282343 (Bos taurus), 403787 (Canis lupus familiaris), 6275 (Homo sapiens), 715115 (Macaca mulatta)
    Gene Symbols & Synonyms S100A4,S100a4,42a,18A2,Capl,FSp1,Mts1,pk9a,PeL98,metastasin,42A,CAPL,MTS1,P9ka,PEL98,RNP9KA,FSP1,P9KA
    Target Alternative Names 18A2,42A,42a,CAPL,Calvasculin,Capl,FSP1,FSp1,MTS1,Metastasin,Mts1,P9KA,P9ka,PEL98,PeL98,Placental calcium-binding protein,Protein Mts1,Protein S100-A4,RNP9KA,S100 calcium-binding protein A4,S100A4,S100a4,metastasin,pk9a
    Uniprot Accession P05942,P07091,P26447,P35466,Q9TV56
    Additional SwissProt Accessions: P07091,P05942,P35466,Q9TV56,P26447
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer, Breast Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000008221, ENSMUSG00000001020, ENSG00000196154, ENSMMUG00000010979
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.