Human S100A13 ORF/cDNA clone-Lentivirus plasmid (NM_005979)

Cat. No.: pGMLP000285
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human S100A13/ Lentiviral expression plasmid for S100A13 lentivirus packaging, S100A13 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to S100A13 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000285
Gene Name S100A13
Accession Number NM_005979
Gene ID 6284
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 297 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGCAGAACCACTGACAGAGCTAGAGGAGTCCATTGAGACCGTGGTCACCACCTTCTTCACCTTTGCAAGGCAGGAGGGCCGGAAGGATAGCCTCAGCGTCAACGAGTTCAAAGAGCTGGTTACCCAGCAGTTGCCCCATCTGCTCAAGGATGTGGGCTCTCTTGATGAGAAGATGAAGAGCTTGGATGTGAATCAGGACTCGGAGCTCAAGTTCAATGAGTACTGGAGATTGATTGGGGAGCTGGCCAAGGAAATCAGGAAGAAGAAAGACCTGAAGATCAGGAAGAAGTAA
ORF Protein Sequence MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2314-Ab Anti-S10AD/ S100A13 monoclonal antibody
    Target Antigen GM-Tg-g-MP2314-Ag S100A13 VLP (virus-like particle)
    ORF Viral Vector pGMLP000285 Human S100A13 Lentivirus plasmid
    ORF Viral Vector vGMLP000285 Human S100A13 Lentivirus particle


    Target information

    Target ID GM-MP2314
    Target Name S100A13
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6284
    Gene ID 100056308 (Equus caballus), 101082121 (Felis catus), 20196 (Mus musculus), 295213 (Rattus norvegicus)
    404146 (Bos taurus), 490457 (Canis lupus familiaris), 6284 (Homo sapiens), 713890 (Macaca mulatta)
    Gene Symbols & Synonyms S100A13,S100a13,S100A1
    Target Alternative Names Protein S100-A13,S100 calcium-binding protein A13,S100A1,S100A13,S100a13
    Uniprot Accession P79342,P97352,Q99584
    Additional SwissProt Accessions: P97352,P79342,Q99584
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSMUSG00000042312, ENSCAFG00845001940, ENSG00000189171
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.