Human RAMP1 ORF/cDNA clone-Lentivirus plasmid (NM_005855)

Cat. No.: pGMLP000292
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RAMP1/ Lentiviral expression plasmid for RAMP1 lentivirus packaging, RAMP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RAMP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000292
Gene Name RAMP1
Accession Number NM_005855
Gene ID 10267
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 447 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCGGGCCCTGTGCCGCCTCCCGCGGCGCGGCCTCTGGCTGCTCCTGGCCCATCACCTCTTCATGACCACTGCCTGCCAGGAGGCTAACTACGGTGCCCTCCTCCGGGAGCTCTGCCTCACCCAGTTCCAGGTAGACATGGAGGCCGTCGGGGAGACGCTGTGGTGTGACTGGGGCAGGACCATCAGGAGCTACAGGGAGCTGGCCGACTGCACCTGGCACATGGCGGAGAAGCTGGGCTGCTTCTGGCCCAATGCAGAGGTGGACAGGTTCTTCCTGGCAGTGCATGGCCGCTACTTCAGGAGCTGCCCCATCTCAGGCAGGGCCGTGCGGGACCCGCCCGGCAGCATCCTCTACCCCTTCATCGTGGTCCCCATCACGGTGACCCTGCTGGTGACGGCACTGGTGGTCTGGCAGAGCAAGCGCACTGAGGGCATTGTGTAG
ORF Protein Sequence MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1451-Ab Anti-RAMP1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1451-Ag RAMP1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000292 Human RAMP1 Lentivirus plasmid
    ORF Viral Vector vGMLP000292 Human RAMP1 Lentivirus particle


    Target information

    Target ID GM-MP1451
    Target Name RAMP1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10267
    Gene ID 100066550 (Equus caballus), 101092133 (Felis catus), 10267 (Homo sapiens), 51801 (Mus musculus)
    574329 (Macaca mulatta), 58965 (Rattus norvegicus), 607163 (Canis lupus familiaris), 617017 (Bos taurus)
    Gene Symbols & Synonyms RAMP1,Ramp1,9130218E19Rik
    Target Alternative Names 9130218E19Rik,Calcitonin-receptor-like receptor activity-modifying protein 1 (CRLR activity-modifying protein 1),RAMP1,Ramp1,Receptor activity-modifying protein 1
    Uniprot Accession O60894,Q9JJ74,Q9WTJ5
    Additional SwissProt Accessions: O60894,Q9WTJ5,Q9JJ74
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Vascular smooth muscle contraction
    Gene Ensembl ENSECAG00000009250, ENSG00000132329, ENSMUSG00000034353, ENSMMUG00000052071, ENSCAFG00845029374, ENSBTAG00000011534
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.