Human EMC4/PIG17/TMEM85 ORF/cDNA clone-Lentivirus plasmid (NM_001286420)

Cat. No.: pGMLP000294
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EMC4/PIG17/TMEM85 Lentiviral expression plasmid for EMC4 lentivirus packaging, EMC4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TMEM85/EMC4/EMC4/PIG17 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000294
Gene Name EMC4
Accession Number NM_001286420
Gene ID 51234
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 450 bp
Gene Alias PIG17,TMEM85
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACGGCCCAGGGGGGCCTGGTGGCTAACCGAGGCCGGCGCTTCAAGTGGGCCATTGAGCTAAGCGGGCCTGGAGGAGGCAGCAGGGGTCGAAGTGACCGGGGCAGTGGCCAGGGAGACTCGCTCTACCCAGTCGGTTACTTGGACAAGCAAGTGCCTGATACCAGCGTGCAAGAGACAGACCGGATCCTGGTGGAGAAGCGCTGCTGGGACATCGCCTTGGGTCCCCTCAAACAGATTCCCATGAATCTCTTCATCATGTACATGGCAGGCAATACTATCTCCATCTTCCCTACTATGATGGTGTGTATGATGGCCTGGCGACCCATTCAGGCACTTATGGCCATTTCAGCCAAGAATGGAGTTCAGTGGTGGAGGACTGCTTTTGTGAACATGAGAAAGCAGCGCCTGGTCCCTATGTATTTGGGTCTTATTTACATCCTTCTTTAA
ORF Protein Sequence MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISAKNGVQWWRTAFVNMRKQRLVPMYLGLIYILL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0755-Ab Anti-EMC4 monoclonal antibody
    Target Antigen GM-Tg-g-IP0755-Ag EMC4 protein
    ORF Viral Vector pGMLP000294 Human EMC4 Lentivirus plasmid
    ORF Viral Vector vGMLP000294 Human EMC4 Lentivirus particle


    Target information

    Target ID GM-IP0755
    Target Name TMEM85/EMC4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		51234
    Gene ID 100057999 (Equus caballus), 101097984 (Felis catus), 296049 (Rattus norvegicus), 478241 (Canis lupus familiaris)
    51234 (Homo sapiens), 523162 (Bos taurus), 68032 (Mus musculus), 695907 (Macaca mulatta)
    Gene Symbols & Synonyms EMC4,Emc4,Tmem85,RGD1310905,TMEM85,PIG17,2610318K02Rik
    Target Alternative Names 2610318K02Rik,Cell proliferation-inducing gene 17 protein,EMC4,ER membrane protein complex subunit 4,Emc4,PIG17,RGD1310905,TMEM85,Tmem85,Transmembrane protein 85
    Uniprot Accession Q3T0K8,Q5J8M3,Q9CZX9
    Additional SwissProt Accessions: Q5J8M3,Q3T0K8,Q9CZX9
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000025049, ENSCAFG00845019980, ENSG00000128463, ENSBTAG00000006416, ENSMUSG00000027131, ENSMMUG00000012335
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.