Human CCL19/CKb11/ELC ORF/cDNA clone-Lentivirus plasmid (NM_006274)
Cat. No.: pGMLP000321
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CCL19/CKb11/ELC Lentiviral expression plasmid for CCL19 lentivirus packaging, CCL19 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
MIP-3 Beta/CCL19/CCL19/CKb11 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000321 |
| Gene Name | CCL19 |
| Accession Number | NM_006274 |
| Gene ID | 6363 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 297 bp |
| Gene Alias | CKb11,ELC,MIP-3b,MIP3B,SCYA19 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCCTGCTACTGGCCCTCAGCCTGCTGGTTCTCTGGACTTCCCCAGCCCCAACTCTGAGTGGCACCAATGATGCTGAAGACTGCTGCCTGTCTGTGACCCAGAAACCCATCCCTGGGTACATCGTGAGGAACTTCCACTACCTTCTCATCAAGGATGGCTGCAGGGTGCCTGCTGTAGTGTTCACCACACTGAGGGGCCGCCAGCTCTGTGCACCCCCAGACCAGCCCTGGGTAGAACGCATCATCCAGAGACTGCAGAGGACCTCAGCCAAGATGAAGCGCCGCAGCAGTTAA |
| ORF Protein Sequence | MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0744-Ab | Anti-CCL19/ CKb11/ ELC functional antibody |
| Target Antigen | GM-Tg-g-SE0744-Ag | CCL19 protein |
| Cytokine | cks-Tg-g-GM-SE0744 | chemokine (C-C motif) ligand 19 (CCL19) protein & antibody |
| ORF Viral Vector | pGMLP000321 | Human CCL19 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001095 | Human CCL19 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000321 | Human CCL19 Lentivirus particle |
| ORF Viral Vector | vGMLV001095 | Human CCL19 Lentivirus particle |
Target information
| Target ID | GM-SE0744 |
| Target Name | MIP-3 Beta/CCL19 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
6363 |
| Gene ID |
101087015 (Felis catus), 24047 (Mus musculus), 362506 (Rattus norvegicus), 448793 (Canis lupus familiaris) 509167 (Bos taurus), 574386 (Macaca mulatta), 6363 (Homo sapiens) |
| Gene Symbols & Synonyms | CCL19,Ccl19,ELC,CKb11,MIP3B,Gm2023,Scya19,exodus-3,MIP-3b,SCYA19 |
| Target Alternative Names | Beta-chemokine exodus-3,C-C motif chemokine 19,CCL19,CK beta-11,CKb11,Ccl19,ELC,ELC),Epstein-Barr virus-induced molecule 1 ligand chemokine (EBI1 ligand chemokine,Gm2023,MIP-3 Beta,MIP-3b,MIP3B,Macrophage inflammatory protein 3 beta (MIP-3-beta),SCYA19,Scya19,Small-inducible cytokine A19,exodus-3 |
| Uniprot Accession |
O70460,Q99731
Additional SwissProt Accessions: O70460,Q99731 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, NF-kappa B signaling pathway |
| Gene Ensembl | ENSMUSG00000071005, ENSCAFG00845005337, ENSBTAG00000012684, ENSMMUG00000016531, ENSG00000172724 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


