Human CAV2/CAV ORF/cDNA clone-Lentivirus plasmid (NM_001233)

Cat. No.: pGMLP000339
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CAV2/CAV Lentiviral expression plasmid for CAV2 lentivirus packaging, CAV2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CAV2/CAV products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000339
Gene Name CAV2
Accession Number NM_001233
Gene ID 858
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 489 bp
Gene Alias CAV
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGCTGGAGACGGAGAAGGCGGACGTACAGCTCTTCATGGACGACGACTCCTACAGCCACCACAGCGGCCTCGAGTACGCCGACCCCGAGAAGTTCGCGGACTCGGACCAGGACCGGGATCCCCACCGGCTCAACTCGCATCTCAAGCTGGGCTTCGAGGATGTGATCGCAGAGCCGGTGACTACGCACTCCTTTGACAAAGTGTGGATCTGCAGCCATGCCCTCTTTGAAATCAGCAAATACGTAATGTACAAGTTCCTGACGGTGTTCCTGGCCATTCCCCTGGCCTTCATTGCGGGAATTCTCTTTGCCACCCTCAGCTGTCTGCACATCTGGATTTTAATGCCTTTTGTAAAGACCTGCCTAATGGTTCTGCCTTCAGTGCAGACAATATGGAAGAGTGTGACAGATGTTATCATTGCTCCATTGTGTACGAGCGTAGGACGATGCTTCTCTTCTGTCAGCCTGCAACTGAGCCAGGATTGA
ORF Protein Sequence MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0186-Ab Anti-CAV2/ CAV monoclonal antibody
    Target Antigen GM-Tg-g-MP0186-Ag CAV2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000339 Human CAV2 Lentivirus plasmid
    ORF Viral Vector vGMLP000339 Human CAV2 Lentivirus particle


    Target information

    Target ID GM-MP0186
    Target Name CAV2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    858
    Gene ID 100071136 (Equus caballus), 12390 (Mus musculus), 363425 (Rattus norvegicus), 475294 (Canis lupus familiaris)
    493642 (Bos taurus), 493667 (Felis catus), 706980 (Macaca mulatta), 858 (Homo sapiens)
    Gene Symbols & Synonyms CAV2,Cav2,CAV-2,Caveolin-2,CAV
    Target Alternative Names CAV,CAV-2,CAV2,Cav2,Caveolin-2
    Uniprot Accession A0M8S6,O46550,P51636,Q2IBC5,Q2QLB1,Q66WT7,Q9WVC3
    Additional SwissProt Accessions: Q2QLB1,Q9WVC3,Q2IBC5,O46550,Q66WT7,A0M8S6,P51636
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG Focal adhesion, Proteoglycans in cancer, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSMUSG00000000058, ENSCAFG00845006745, ENSBTAG00000062162, ENSMMUG00000061706, ENSG00000105971
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.