Human PTGES/MGST-IV/MGST1-L1 ORF/cDNA clone-Lentivirus plasmid (NM_004878)

Cat. No.: pGMLP000341
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PTGES/MGST-IV/MGST1-L1 Lentiviral expression plasmid for PTGES lentivirus packaging, PTGES lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PTGES/MGST-IV products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000341
Gene Name PTGES
Accession Number NM_004878
Gene ID 9536
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 459 bp
Gene Alias MGST-IV,MGST1-L1,MGST1L1,MPGES,mPGES-1,PGES,PIG12,PP102,PP1294,TP53I12
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTGCCCACAGCCTGGTGATGAGCAGCCCGGCCCTCCCGGCCTTCCTGCTCTGCAGCACGCTGCTGGTCATCAAGATGTACGTGGTGGCCATCATCACGGGCCAAGTGAGGCTGCGGAAGAAGGCCTTTGCCAACCCCGAGGATGCCCTGAGACACGGAGGCCCCCAGTATTGCAGGAGCGACCCCGACGTGGAACGCTGCCTCAGGGCCCACCGGAACGACATGGAGACCATCTACCCCTTCCTTTTCCTGGGCTTCGTCTACTCCTTTCTGGGTCCTAACCCTTTTGTCGCCTGGATGCACTTCCTGGTCTTCCTCGTGGGCCGTGTGGCACACACCGTGGCCTACCTGGGGAAGCTGCGGGCACCCATCCGCTCCGTGACCTACACCCTGGCCCAGCTCCCCTGCGCCTCCATGGCTCTGCAGATCCTCTGGGAAGCGGCCCGCCACCTGTGA
ORF Protein Sequence MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0039-Ab Anti-PTGES monoclonal antibody
    Target Antigen GM-Tg-g-IP0039-Ag PTGES protein
    ORF Viral Vector pGMLP000341 Human PTGES Lentivirus plasmid
    ORF Viral Vector pGMPC001111 Human PTGES Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000341 Human PTGES Lentivirus particle


    Target information

    Target ID GM-IP0039
    Target Name PTGES
    Gene Group Identifier
    （Target Gene ID in Homo species)         		9536
    Gene ID 100034143 (Equus caballus), 101086187 (Felis catus), 282019 (Bos taurus), 480698 (Canis lupus familiaris)
    59103 (Rattus norvegicus), 64292 (Mus musculus), 716657 (Macaca mulatta), 9536 (Homo sapiens)
    Gene Symbols & Synonyms PTGES,Ptges,MPGES-1,PGES,Pges,mPGES-1,mPGES,D2Ertd369e,2410099E23Rik,MPGES,PIG12,PP102,PP1294,MGST-IV,MGST1L1,TP53I12,MGST1-L1
    Target Alternative Names 2410099E23Rik,D2Ertd369e,Glutathione peroxidase PTGES,Glutathione transferase PTGES,MGST-IV,MGST1-L1,MGST1L1,MPGES,MPGES-1,Microsomal glutathione S-transferase 1-like 1 (MGST1-L1),Microsomal prostaglandin E synthase 1 (MPGES-1),PGES,PIG12,PP102,PP1294,PTGES,Pges,Prostaglandin E synthase,Ptges,TP53I12,mPGES,mPGES-1,p53-induced gene 12 protein
    Uniprot Accession A0SYQ0,O14684,Q8HZJ2,Q95L14,Q9JHF3,Q9JM51
    Additional SwissProt Accessions: Q8HZJ2,Q95L14,A0SYQ0,Q9JHF3,Q9JM51,O14684
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Metabolic pathways, Arachidonic acid metabolism
    Gene Ensembl ENSECAG00000000943, ENSBTAG00000019453, ENSCAFG00845023377, ENSMUSG00000050737, ENSG00000148344
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.