Human MYL1/MLC1F/MLC3F ORF/cDNA clone-Lentivirus plasmid (NM_079422)

Cat. No.: pGMLP000342
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MYL1/MLC1F/MLC3F Lentiviral expression plasmid for MYL1 lentivirus packaging, MYL1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to MYL1/MLC1F products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000342
Gene Name MYL1
Accession Number NM_079422
Gene ID 4632
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 453 bp
Gene Alias MLC1F,MLC3F
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCTTCAGTGCTGACCAGATTGCTGAATTCAAGGAGGCATTTCTCCTGTTTGACAGAACAGGTGATTCCAAGATCACCTTAAGCCAGGTCGGTGATGTCCTTCGAGCTCTGGGCACAAATCCCACCAATGCAGAGGTCAGGAAAGTTCTGGGAAACCCCAGCAATGAAGAGCTGAATGCCAAGAAAATTGAGTTTGAACAATTTCTGCCTATGATGCAAGCCATTTCCAACAACAAGGACCAGGCCACCTATGAAGACTTTGTTGAGGGTCTGCGTGTCTTTGACAAGGAAGGCAATGGCACAGTCATGGGTGCTGAACTCCGCCATGTTCTAGCCACCCTGGGTGAAAAGATGAAAGAGGAAGAAGTGGAAGCCCTGATGGCAGGTCAAGAAGACTCCAATGGCTGCATCAACTACGAAGCTTTTGTCAAGCACATCATGTCTATCTGA
ORF Protein Sequence MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1588-Ab Anti-MYL1/ MLC1F/ MLC3F functional antibody
    Target Antigen GM-Tg-g-SE1588-Ag MYL1 protein
    ORF Viral Vector pGMLP000342 Human MYL1 Lentivirus plasmid
    ORF Viral Vector vGMLP000342 Human MYL1 Lentivirus particle


    Target information

    Target ID GM-SE1588
    Target Name MYL1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4632
    Gene ID 100052501 (Equus caballus), 101099140 (Felis catus), 17901 (Mus musculus), 317657 (Bos taurus)
    4632 (Homo sapiens), 478896 (Canis lupus familiaris), 56781 (Rattus norvegicus), 711561 (Macaca mulatta)
    Gene Symbols & Synonyms MYL1,Myl1,Mylf,MLC1f,MLC3f,MLC1,MLC-1,MLC1F,MLC3F,CMYO14,CMYP14,MLC1/3,MYOFTA,MLCf,Mcl3,Mlc1,Mlc3,MLC-f,MLC3-f
    Target Alternative Names CMYO14,CMYP14,MLC-1,MLC-f,MLC1,MLC1/3,MLC1/MLC3,MLC1F,MLC1F/MLC3F,MLC1f,MLC3-f,MLC3F,MLC3f,MLCf,MYL1,MYOFTA,Mcl3,Mlc1,Mlc3,Myl1,Mylf,Myosin light chain 1/3,Myosin light chain alkali 1/2 (Myosin light chain A1/A2),skeletal muscle isoform
    Uniprot Accession A0JNJ5,P02600,P05976,P05977
    Additional SwissProt Accessions: P05977,A0JNJ5,P05976,P02600
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000005145, ENSMUSG00000061816, ENSBTAG00000009707, ENSG00000168530, ENSCAFG00845017241, ENSMMUG00000010519
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.