Human UBE2C/dJ447F3.2/UBCH10 ORF/cDNA clone-Lentivirus plasmid (NM_007019)

Cat. No.: pGMLP000350
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human UBE2C/dJ447F3.2/UBCH10 Lentiviral expression plasmid for UBE2C lentivirus packaging, UBE2C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to UBE2C/dJ447F3.2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $435
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000350
Gene Name UBE2C
Accession Number NM_007019
Gene ID 11065
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 540 bp
Gene Alias dJ447F3.2,UBCH10
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTCCCAAAACCGCGACCCAGCCGCCACTAGCGTCGCCGCCGCCCGTAAAGGAGCTGAGCCGAGCGGGGGCGCCGCCCGGGGTCCGGTGGGCAAAAGGCTACAGCAGGAGCTGATGACCCTCATGATGTCTGGCGATAAAGGGATTTCTGCCTTCCCTGAATCAGACAACCTTTTCAAATGGGTAGGGACCATCCATGGAGCAGCTGGAACAGTATATGAAGACCTGAGGTATAAGCTCTCGCTAGAGTTCCCCAGTGGCTACCCTTACAATGCGCCCACAGTGAAGTTCCTCACGCCCTGCTATCACCCCAACGTGGACACCCAGGGTAACATATGCCTGGACATCCTGAAGGAAAAGTGGTCTGCCCTGTATGATGTCAGGACCATTCTGCTCTCCATCCAGAGCCTTCTAGGAGAACCCAACATTGATAGTCCCTTGAACACACATGCTGCCGAGCTCTGGAAAAACCCCACAGCTTTTAAGAAGTACCTGCAAGAAACCTACTCAAAGCAGGTCACCAGCCAGGAGCCCTGA
ORF Protein Sequence MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2372-Ab Anti-UBE2C/ UBCH10/ dJ447F3.2 monoclonal antibody
    Target Antigen GM-Tg-g-MP2372-Ag UBE2C VLP (virus-like particle)
    ORF Viral Vector pGMLP000350 Human UBE2C Lentivirus plasmid
    ORF Viral Vector pGMPC001489 Human UBE2C Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001832 Human UBE2C Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000350 Human UBE2C Lentivirus particle


    Target information

    Target ID GM-MP2372
    Target Name UBE2C
    Gene Group Identifier
    （Target Gene ID in Homo species)         		11065
    Gene ID 100056334 (Equus caballus), 101087052 (Felis catus), 11065 (Homo sapiens), 296368 (Rattus norvegicus)
    485898 (Canis lupus familiaris), 506962 (Bos taurus), 68612 (Mus musculus), 709380 (Macaca mulatta)
    Gene Symbols & Synonyms UBE2C,Ube2c,UBCH10,dJ447F3.2,D2Ertd695e,1110015A16Rik
    Target Alternative Names (E3-independent) E2 ubiquitin-conjugating enzyme C,1110015A16Rik,D2Ertd695e,E2 ubiquitin-conjugating enzyme C,UBCH10,UBE2C,UbcH10,Ube2c,Ubiquitin carrier protein C,Ubiquitin-conjugating enzyme E2 C,Ubiquitin-protein ligase C,dJ447F3.2
    Uniprot Accession O00762,Q32PA5,Q9D1C1
    Additional SwissProt Accessions: O00762,Q32PA5,Q9D1C1
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer, Breast Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000014619, ENSG00000175063, ENSCAFG00845015750, ENSBTAG00000016746, ENSMUSG00000001403, ENSMMUG00000021023
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.