Human RPP14/P14 ORF/cDNA clone-Lentivirus plasmid (NM_007042)

Cat. No.: pGMLP000371
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RPP14/P14 Lentiviral expression plasmid for RPP14 lentivirus packaging, RPP14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RPP14/P14 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000371
Gene Name RPP14
Accession Number NM_007042
Gene ID 11102
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 375 bp
Gene Alias P14
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTGCCCCTGCTGCCACATATGAAAGAGTAGTTTACAAAAACCCTTCCGAGTACCACTACATGAAAGTCTGCCTAGAATTTCAAGATTGTGGAGTTGGACTGAATGCTGCACAGTTCAAACAGCTGCTTATTTCGGCTGTGAAGGACCTGTTTGGGGAGGTTGATGCCGCCTTACCTTTGGACATCCTAACCTATGAAGAGAAGACCTTGTCAGCCATCTTGAGAATATGTAGCAGTGGTCTTGTCAAATTGTGGAGCTCTTTGACCCTGTTAGGATCCTATAAAGGCAAAAAATGTGCTTTCCGGGTGATTCAGGTTTCTCCATTTCTTCTTGCATTATCTGGTAATAGTAGGGAACTAGTATTGGATTGA
ORF Protein Sequence MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA047-Ab Anti-RPP14 monoclonal antibody
    Target Antigen GM-Tg-g-TA047-Ag RPP14 protein
    ORF Viral Vector pGMLP000371 Human RPP14 Lentivirus plasmid
    ORF Viral Vector vGMLP000371 Human RPP14 Lentivirus particle


    Target information

    Target ID GM-TA047
    Target Name RPP14
    Gene Group Identifier
    （Target Gene ID in Homo species)         		11102
    Gene ID 100630485 (Equus caballus), 101099867 (Felis catus), 11102 (Homo sapiens), 361020 (Rattus norvegicus)
    515208 (Bos taurus), 612771 (Canis lupus familiaris), 67053 (Mus musculus), 706788 (Macaca mulatta)
    Gene Symbols & Synonyms RPP14,Rpp14,P14,2610511E03Rik
    Target Alternative Names 2610511E03Rik,P14,RPP14,Ribonuclease P protein subunit p14,Rpp14
    Uniprot Accession O95059,Q9CQH8
    Additional SwissProt Accessions: O95059,Q9CQH8
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSG00000163684, ENSMUSG00000023156
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.