Human MCFD2/F5F8D/F5F8D2 ORF/cDNA clone-Lentivirus plasmid (NM_139279)

Cat. No.: pGMLP000374
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MCFD2/F5F8D/F5F8D2 Lentiviral expression plasmid for MCFD2 lentivirus packaging, MCFD2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to MCFD2/F5F8D products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000374
Gene Name MCFD2
Accession Number NM_139279
Gene ID 90411
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 441 bp
Gene Alias F5F8D,F5F8D2,LMAN1IP,SDNSF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCATGAGATCCCTGCTCAGAACCCCCTTCCTGTGTGGCCTGCTCTGGGCCTTTTGTGCCCCAGGCGCCAGGGCTGAGGAGCCTGCAGCCAGCTTCTCCCAACCCGGCAGCATGGGCCTGGATAAGAACACAGTGCACGACCAAGAGCATATCATGGAGCATCTAGAAGGTGTCATCAACAAACCAGAGGCGGAGATGTCGCCACAAGAATTGCAGCTCCATTACTTCAAAATGCATGATTATGATGGCAATAATTTGCTTGATGGCTTAGAACTCTCCACAGCCATCACTCATGTCCATAAGGAGGAAGGGAGTGAACAGGCACCACTAATGAGTGAAGATGAACTGATTAACATAATAGATGGTGTTTTGAGAGATGATGACAAGAACAATGATGGATACATTGACTATGCTGAATTTGCAAAATCACTGCAGTAG
ORF Protein Sequence MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1626-Ab Anti-MCFD2/ F5F8D/ F5F8D2 functional antibody
    Target Antigen GM-Tg-g-SE1626-Ag MCFD2 protein
    ORF Viral Vector pGMLP000374 Human MCFD2 Lentivirus plasmid
    ORF Viral Vector vGMLP000374 Human MCFD2 Lentivirus particle


    Target information

    Target ID GM-SE1626
    Target Name MCFD2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		90411
    Gene ID 100068298 (Equus caballus), 101081285 (Felis catus), 193813 (Mus musculus), 246117 (Rattus norvegicus)
    474582 (Canis lupus familiaris), 616647 (Bos taurus), 717900 (Macaca mulatta), 90411 (Homo sapiens)
    Gene Symbols & Synonyms MCFD2,Mcfd2,F5f8d,Sdnsf,Lman1ip,1810021C21Rik,F5F8D,SDNSF,F5F8D2,LMAN1IP
    Target Alternative Names 1810021C21Rik,F5F8D,F5F8D2,F5f8d,LMAN1IP,Lman1ip,MCFD2,Mcfd2,Multiple coagulation factor deficiency protein 2,Neural stem cell-derived neuronal survival protein,SDNSF,Sdnsf
    Uniprot Accession Q8K5B2,Q8K5B3,Q8NI22
    Additional SwissProt Accessions: Q8K5B2,Q8K5B3,Q8NI22
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSMUSG00000024150, ENSMMUG00000042395, ENSG00000180398
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.