Human CISD2/ERIS/Miner1 ORF/cDNA clone-Lentivirus plasmid (NM_001008388)

Cat. No.: pGMLP000388
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CISD2/ERIS/Miner1 Lentiviral expression plasmid for CISD2 lentivirus packaging, CISD2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CISD2/ERIS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000388
Gene Name CISD2
Accession Number NM_001008388
Gene ID 493856
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 408 bp
Gene Alias ERIS,Miner1,NAF-1,WFS2,ZCD2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGCTGGAGAGCGTGGCCCGTATCGTGAAGGTGCAGCTCCCTGCATATCTGAAGCGGCTCCCAGTCCCTGAAAGCATTACCGGGTTCGCTAGGCTCACAGTTTCAGAATGGCTTCGGTTATTGCCTTTCCTTGGTGTACTCGCACTTCTTGGCTACCTTGCAGTTCGTCCATTCCTCCCGAAGAAGAAACAACAGAAGGATAGCTTGATTAATCTTAAAATACAAAAGGAAAATCCGAAAGTAGTGAATGAAATAAACATTGAAGATTTGTGTCTTACTAAAGCAGCTTATTGTAGGTGTTGGCGTTCTAAAACGTTTCCTGCCTGCGATGGTTCACATAATAAACACAATGAATTGACAGGAGATAATGTGGGTCCACTAATACTGAAGAAGAAAGAAGTATAA
ORF Protein Sequence MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0551-Ab Anti-CISD2 monoclonal antibody
    Target Antigen GM-Tg-g-IP0551-Ag CISD2 protein
    ORF Viral Vector pGMLP000388 Human CISD2 Lentivirus plasmid
    ORF Viral Vector vGMLP000388 Human CISD2 Lentivirus particle


    Target information

    Target ID GM-IP0551
    Target Name CISD2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		493856
    Gene ID 100429989 (Macaca mulatta), 100630458 (Equus caballus), 101094592 (Felis catus), 106558129 (Canis lupus familiaris)
    295457 (Rattus norvegicus), 493856 (Homo sapiens), 67006 (Mus musculus), 781260 (Bos taurus)
    Gene Symbols & Synonyms CISD2,Cisd2,ZCD2,RGD1566242,ERIS,WFS2,NAF-1,Miner1,Zcd2,Naf-1,Noxp70,1500009M05Rik,1500026J14Rik,1500031D15Rik,B630006A20Rik
    Target Alternative Names 1500009M05Rik,1500026J14Rik,1500031D15Rik,B630006A20Rik,CDGSH iron-sulfur domain-containing protein 2,CISD2,Cisd2,ERIS,Endoplasmic reticulum intermembrane small protein,Miner1,MitoNEET-related 1 protein (Miner1),NAF-1,Naf-1,Noxp70,Nutrient-deprivation autophagy factor-1 (NAF-1),RGD1566242,WFS2,ZCD2,Zcd2
    Uniprot Accession Q05B71,Q8N5K1,Q9CQB5
    Additional SwissProt Accessions: Q8N5K1,Q9CQB5,Q05B71
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSMMUG00000061265, ENSCAFG00845026505, ENSG00000145354, ENSMUSG00000028165
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.