Human APOC1/Apo-CI/apo-CIB ORF/cDNA clone-Lentivirus plasmid (NM_001645)

Cat. No.: pGMLP000390
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human APOC1/Apo-CI/apo-CIB Lentiviral expression plasmid for APOC1 lentivirus packaging, APOC1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to APOC1/Apo-CI products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000390
Gene Name APOC1
Accession Number NM_001645
Gene ID 341
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 252 bp
Gene Alias Apo-CI,apo-CIB,ApoC-I,apoC-IB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGCTCTTCCTGTCGCTCCCGGTCCTGGTGGTGGTTCTGTCGATCGTCTTGGAAGGCCCAGCCCCAGCCCAGGGGACCCCAGACGTCTCCAGTGCCTTGGATAAGCTGAAGGAGTTTGGAAACACACTGGAGGACAAGGCTCGGGAACTCATCAGCCGCATCAAACAGAGTGAACTTTCTGCCAAGATGCGGGAGTGGTTTTCAGAGACATTTCAGAAAGTGAAGGAGAAACTCAAGATTGACTCATGA
ORF Protein Sequence MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0672-Ab Anti-APOC1/ Apo-CI/ ApoC-I functional antibody
    Target Antigen GM-Tg-g-SE0672-Ag APOC1 protein
    ORF Viral Vector pGMLP000390 Human APOC1 Lentivirus plasmid
    ORF Viral Vector vGMLP000390 Human APOC1 Lentivirus particle


    Target information

    Target ID GM-SE0672
    Target Name APOC1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		341
    Gene ID 101086520 (Felis catus), 106994799 (Macaca mulatta), 11812 (Mus musculus), 25292 (Rattus norvegicus)
    341 (Homo sapiens), 476437 (Canis lupus familiaris)
    Gene Symbols & Synonyms APOC1,Apoc1,Apo-CI,ApoC-I,APOC1B,Apo-CIB,ApoC-IB,apo-CI,apoC-I,ALPCI,LRRG04,apo-CIB,apoC-IB
    Target Alternative Names ALPCI,APOC1,APOC1B,Apo-CI,Apo-CIB,ApoC-I,ApoC-IB,Apoc1,Apolipoprotein C-I,Apolipoprotein C1,LRRG04,apo-CI,apo-CIB,apoC-I,apoC-IB
    Uniprot Accession H9FNA4,P02654,P0DM82,P19939,P34928,P56595
    Additional SwissProt Accessions: P0DM82,H9FNA4,P34928,P19939,P02654,P56595
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease gastric cancer
    Disease from KEGG Cholesterol metabolism
    Gene Ensembl ENSMMUG00000028749, ENSMUSG00000040564, ENSG00000130208, ENSCAFG00845006666
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.