Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
Plasmid quantity:
- 10mg, 50mg, 100mg, 500mg, >1g
Talk to our Expert:
- • Research Grade
- • Endotoxin-Free Grade
- • High Quality (HQ) Grade
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human IL1RN/ICIL-1RA/IL-1ra3 ORF/cDNA clone-Lentivirus plasmid (BC009745)
Cat. No.: pGMLP000397
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL1RN/ICIL-1RA/IL-1ra3 Lentiviral expression plasmid for IL1RN lentivirus packaging, IL1RN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Datasheet
Go to
IL-1RA/IL1RN/IL1RN/ICIL-1RA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000397 |
| Gene Name | IL1RN |
| Accession Number | BC009745 |
| Gene ID | 3557 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 480 bp |
| Gene Alias | ICIL-1RA,IL-1ra3,IL1F3,IL1RA,IRAP,MGC10430 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTTTAGAGACGATCTGCCGACCCTCTGGGAGAAAATCCAGCAAGATGCAAGCCTTCAGAATCTGGGATGTTAACCAGAAGACCTTCTATCTGAGGAACAACCAACTAGTTGCCGGATACTTGCAAGGACCAAATGTCAATTTAGAAGAAAAGATAGATGTGGTACCCATTGAGCCTCATGCTCTGTTCTTGGGAATCCATGGAGGGAAGATGTGCCTGTCCTGTGTCAAGTCTGGTGATGAGACCAGACTCCAGCTGGAGGCAGTTAACATCACTGACCTGAGCGAGAACAGAAAGCAGGACAAGCGCTTCGCCTTCATCCGCTCAGACAGTGGCCCCACCACCAGTTTTGAGTCTGCCGCCTGCCCCGGTTGGTTCCTCTGCACAGCGATGGAAGCTGACCAGCCCGTCAGCCTCACCAATATGCCTGACGAAGGCGTCATGGTCACCAAATTCTACTTCCAGGAGGACGAGTAG |
| ORF Protein Sequence | MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP2544-Ab | Anti-IL1RA/ IL1RN/ DIRA monoclonal antibody |
| Target Antigen | GM-Tg-g-MP2544-Ag | IL1RN VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-MP2544 | interleukin 1 receptor antagonist (IL1RN) protein & antibody |
| ORF Viral Vector | pGMLP000397 | Human IL1RN Lentivirus plasmid |
| ORF Viral Vector | pGMAP000045 | Human IL1RN Adenovirus plasmid |
| ORF Viral Vector | pGMLP-IL-004 | Human IL1RN Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-087 | Human IL1RN Adenovirus plasmid |
| ORF Viral Vector | vGMLP000397 | Human IL1RN Lentivirus particle |
| ORF Viral Vector | vGMAP000045 | Human IL1RN Adenovirus particle |
| ORF Viral Vector | vGMLP-IL-004 | Human IL1RN Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-087 | Human IL1RN Adenovirus particle |
Target information
| Target ID | GM-MP2544 |
| Target Name | IL-1RA/IL1RN |
|
Gene Group Identifier （Target Gene ID in Homo species) |
3557 |
| Gene ID |
100034236 (Equus caballus), 16181 (Mus musculus), 281860 (Bos taurus), 3557 (Homo sapiens) 403660 (Canis lupus familiaris), 60582 (Rattus norvegicus), 701658 (Macaca mulatta) |
| Gene Symbols & Synonyms | IL1RN,Il1rn,IL-1RA,IL-1ra,F630041P17Rik,DIRA,IRAP,CRMO2,IL1F3,IL1RA,MVCD4,IL-1RN,IL-1ra3,ICIL-1RA,Il1ra |
| Target Alternative Names | CRMO2,DIRA,F630041P17Rik,ICIL-1RA,IL-1RA,IL-1RN,IL-1ra,IL-1ra3,IL1 inhibitor,IL1F3,IL1RA,IL1RN,IRAP,Il1ra,Il1rn,Interleukin-1 receptor antagonist protein,MVCD4 |
| Uniprot Accession |
O18999,O77482,P18510,P25085,P25086,Q9BEH0
Additional SwissProt Accessions: O18999,P25085,O77482,P18510,Q9BEH0,P25086 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Cytokine Target |
| Disease | cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction |
| Gene Ensembl | ENSMUSG00000026981, ENSBTAG00000019665, ENSG00000136689, ENSCAFG00845011971, ENSMMUG00000013014 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.