Human TGFA/TFGA ORF/cDNA clone-Lentivirus plasmid (NM_001099691)

Cat. No.: pGMLP000405
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TGFA/TFGA Lentiviral expression plasmid for TGFA lentivirus packaging, TGFA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TGF Alpha/TGFA/TGFA/TFGA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000405
Gene Name TGFA
Accession Number NM_001099691
Gene ID 7039
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 480 bp
Gene Alias TFGA
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTCCCCTCGGCTGGACAGCTCGCCCTGTTCGCTCTGGGTATTGTGTTGGCTGCGTGCCAGGCCTTGGAGAACAGCACGTCCCCGCTGAGTGACCCGCCCGTGGCTGCAGCAGTGGTGTCCCATTTTAATGACTGCCCAGATTCCCACACTCAGTTCTGCTTCCATGGAACCTGCAGGTTTTTGGTGCAGGAGGACAAGCCAGCATGTGTCTGCCATTCTGGGTACGTTGGTGCACGCTGTGAGCATGCGGACCTCCTGGCCGTGGTGGCTGCCAGCCAGAAGAAGCAGGCCATCACCGCCTTGGTGGTGGTCTCCATCGTGGCCCTGGCTGTCCTTATCATCACATGTGTGCTGATACACTGCTGCCAGGTCCGAAAACACTGTGAGTGGTGCCGGGCCCTCATCTGCCGGCACGAGAAGCCCAGCGCCCTCCTGAAGGGAAGAACCGCTTGCTGCCACTCAGAAACAGTGGTCTGA
ORF Protein Sequence MVPSAGQLALFALGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T00033-Ab Anti-TGFA/ TFGA monoclonal antibody
    Target Antigen GM-Tg-g-T00033-Ag TGFA VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T00033 transforming growth factor, alpha (TGFA) protein & antibody
    ORF Viral Vector pGMLP000405 Human TGFA Lentivirus plasmid
    ORF Viral Vector pGMAP000120 Human TGFA Adenovirus plasmid
    ORF Viral Vector vGMLP000405 Human TGFA Lentivirus particle
    ORF Viral Vector vGMAP000120 Human TGFA Adenovirus particle


    Target information

    Target ID GM-T00033
    Target Name TGF Alpha/TGFA
    Gene Group Identifier
    (Target Gene ID in Homo species)
    7039
    Gene ID 100060423 (Equus caballus), 101094921 (Felis catus), 21802 (Mus musculus), 24827 (Rattus norvegicus)
    403431 (Canis lupus familiaris), 540388 (Bos taurus), 613031 (Macaca mulatta), 7039 (Homo sapiens)
    Gene Symbols & Synonyms TGFA,Tgfa,wa1,wa-1,TGFAA,RATTGFAA,TGF alpha,TFGA
    Target Alternative Names Protransforming growth factor alpha,RATTGFAA,TFGA,TGF Alpha,TGF alpha,TGFA,TGFAA,Tgfa,wa-1,wa1
    Uniprot Accession P01134,P01135,P48030,P55244
    Additional SwissProt Accessions: P48030,P01134,P55244,P01135
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Cytokine Target
    Disease cancer, cancer patients
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, ErbB signaling pathway, Ras signaling pathway, PI3K-Akt signaling pathway, Pathways in cancer, Colorectal cancer, Renal cell carcinoma, Pancreatic cancer, Glioma, Prostate cancer, Non-small cell lung cancer, Hepatocellular carcinoma
    Gene Ensembl ENSECAG00000011006, ENSMUSG00000029999, ENSCAFG00845027844, ENSBTAG00000000783, ENSMMUG00000010591, ENSG00000163235
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.