Human TGFA/TFGA ORF/cDNA clone-Lentivirus plasmid (NM_001099691)
Cat. No.: pGMLP000405
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TGFA/TFGA Lentiviral expression plasmid for TGFA lentivirus packaging, TGFA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TGF Alpha/TGFA/TGFA/TFGA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000405 |
| Gene Name | TGFA |
| Accession Number | NM_001099691 |
| Gene ID | 7039 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 480 bp |
| Gene Alias | TFGA |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGTCCCCTCGGCTGGACAGCTCGCCCTGTTCGCTCTGGGTATTGTGTTGGCTGCGTGCCAGGCCTTGGAGAACAGCACGTCCCCGCTGAGTGACCCGCCCGTGGCTGCAGCAGTGGTGTCCCATTTTAATGACTGCCCAGATTCCCACACTCAGTTCTGCTTCCATGGAACCTGCAGGTTTTTGGTGCAGGAGGACAAGCCAGCATGTGTCTGCCATTCTGGGTACGTTGGTGCACGCTGTGAGCATGCGGACCTCCTGGCCGTGGTGGCTGCCAGCCAGAAGAAGCAGGCCATCACCGCCTTGGTGGTGGTCTCCATCGTGGCCCTGGCTGTCCTTATCATCACATGTGTGCTGATACACTGCTGCCAGGTCCGAAAACACTGTGAGTGGTGCCGGGCCCTCATCTGCCGGCACGAGAAGCCCAGCGCCCTCCTGAAGGGAAGAACCGCTTGCTGCCACTCAGAAACAGTGGTCTGA |
| ORF Protein Sequence | MVPSAGQLALFALGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T00033-Ab | Anti-TGFA/ TFGA monoclonal antibody |
| Target Antigen | GM-Tg-g-T00033-Ag | TGFA VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-T00033 | transforming growth factor, alpha (TGFA) protein & antibody |
| ORF Viral Vector | pGMLP000405 | Human TGFA Lentivirus plasmid |
| ORF Viral Vector | pGMAP000120 | Human TGFA Adenovirus plasmid |
| ORF Viral Vector | vGMLP000405 | Human TGFA Lentivirus particle |
| ORF Viral Vector | vGMAP000120 | Human TGFA Adenovirus particle |
Target information
| Target ID | GM-T00033 |
| Target Name | TGF Alpha/TGFA |
|
Gene Group Identifier (Target Gene ID in Homo species) |
7039 |
| Gene ID |
100060423 (Equus caballus), 101094921 (Felis catus), 21802 (Mus musculus), 24827 (Rattus norvegicus) 403431 (Canis lupus familiaris), 540388 (Bos taurus), 613031 (Macaca mulatta), 7039 (Homo sapiens) |
| Gene Symbols & Synonyms | TGFA,Tgfa,wa1,wa-1,TGFAA,RATTGFAA,TGF alpha,TFGA |
| Target Alternative Names | Protransforming growth factor alpha,RATTGFAA,TFGA,TGF Alpha,TGF alpha,TGFA,TGFAA,Tgfa,wa-1,wa1 |
| Uniprot Accession |
P01134,P01135,P48030,P55244
Additional SwissProt Accessions: P48030,P01134,P55244,P01135 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Cytokine Target |
| Disease | cancer, cancer patients |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, ErbB signaling pathway, Ras signaling pathway, PI3K-Akt signaling pathway, Pathways in cancer, Colorectal cancer, Renal cell carcinoma, Pancreatic cancer, Glioma, Prostate cancer, Non-small cell lung cancer, Hepatocellular carcinoma |
| Gene Ensembl | ENSECAG00000011006, ENSMUSG00000029999, ENSCAFG00845027844, ENSBTAG00000000783, ENSMMUG00000010591, ENSG00000163235 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


