Human GPX7/CL683/FLJ14777 ORF/cDNA clone-Lentivirus plasmid (BC032788)

Cat. No.: pGMLP000411
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GPX7/CL683/FLJ14777 Lentiviral expression plasmid for GPX7 lentivirus packaging, GPX7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GPX7/CL683 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $441
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000411
Gene Name GPX7
Accession Number BC032788
Gene ID 2882
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 564 bp
Gene Alias CL683,FLJ14777,GPX6,NPGPx
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGGCGGCGACGGTGGCAGCGGCGTGGCTGCTCCTGTGGGCTGCGGCCTGCGCGCAGCAGGAGCAGGACTTCTACGACTTCAAGGCGGTCAACATCCGGGGCAAACTGGTGTCGCTGGAGAAGTACCGCGGATCGGTGTCCCTGGTGGTGAATGTGGCCAGCGAGTGCGGCTTCACAGACCAGCACTACCGAGCCCTGCAGCAGCTGCAGCGAGACCTGGGCCCCCACCACTTCAACGTGCTCGCCTTCCCCTGCAACCAGTTTGGCCAACAGGAGCCTGACAGCAACAAGGAGATTGAGAGCTTTGCCCGCCGCACCTACAGTGTCTCATTCCCCATGTTTAGCAAGATTGCAGTCACCGGTACTGGTGCCCATCCTGCCTTCAAGTACCTGGCCCAGACTTCTGGGAAGGAGCCCACCTGGAACTTCTGGAAGTACCTAGTAGCCCCAGATGGAAAGGTGGTAGGGGCTTGGGACCCAACTGTGTCAGTGGAGGAGGTCAGACCCCAGATCACAGCGCTCGTGAGGAAGCTCATCCTACTGAAGCGAGAAGACTTATAA
ORF Protein Sequence MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0958-Ab Anti-GPX7/ CL683/ GPX6 functional antibody
    Target Antigen GM-Tg-g-SE0958-Ag GPX7 protein
    ORF Viral Vector pGMLP000411 Human GPX7 Lentivirus plasmid
    ORF Viral Vector pGMLV002116 Human GPX7 Lentivirus plasmid
    ORF Viral Vector vGMLP000411 Human GPX7 Lentivirus particle
    ORF Viral Vector vGMLV002116 Human GPX7 Lentivirus particle


    Target information

    Target ID GM-SE0958
    Target Name GPX7
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2882
    Gene ID 100050590 (Equus caballus), 101091642 (Felis catus), 2882 (Homo sapiens), 298376 (Rattus norvegicus)
    475348 (Canis lupus familiaris), 523311 (Bos taurus), 67305 (Mus musculus), 715474 (Macaca mulatta)
    Gene Symbols & Synonyms GPX7,Gpx7,GPX6,CL683,GPx-7,NPGPx,GSHPx-7,3110050F08Rik
    Target Alternative Names 3110050F08Rik,CL683,GPX6,GPX7,GPx-7,GSHPx-7,Glutathione peroxidase 7,Gpx7,NPGPx
    Uniprot Accession A6QLY2,Q96SL4,Q99LJ6
    Additional SwissProt Accessions: Q96SL4,A6QLY2,Q99LJ6
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Metabolic pathways, Thyroid hormone synthesis, Arachidonic acid metabolism
    Gene Ensembl ENSG00000116157, ENSCAFG00845018194, ENSMUSG00000028597, ENSMMUG00000061256
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.