Human GDF15/GDF-15/MIC-1 ORF/cDNA clone-Lentivirus plasmid (NM_004864)

Cat. No.: pGMLP000446
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GDF15/GDF-15/MIC-1 Lentiviral expression plasmid for GDF15 lentivirus packaging, GDF15 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GDF15/GDF-15 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $531.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000446
Gene Name GDF15
Accession Number NM_004864
Gene ID 9518
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 927 bp
Gene Alias GDF-15,MIC-1,MIC1,NAG-1,PDF,PLAB,PTGFB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCCGGGCAAGAACTCAGGACGGTGAATGGCTCTCAGATGCTCCTGGTGTTGCTGGTGCTCTCGTGGCTGCCGCATGGGGGCGCCCTGTCTCTGGCCGAGGCGAGCCGCGCAAGTTTCCCGGGACCCTCAGAGTTGCACTCCGAAGACTCCAGATTCCGAGAGTTGCGGAAACGCTACGAGGACCTGCTAACCAGGCTGCGGGCCAACCAGAGCTGGGAAGATTCGAACACCGACCTCGTCCCGGCCCCTGCAGTCCGGATACTCACGCCAGAAGTGCGGCTGGGATCCGGCGGCCACCTGCACCTGCGTATCTCTCGGGCCGCCCTTCCCGAGGGGCTCCCCGAGGCCTCCCGCCTTCACCGGGCTCTGTTCCGGCTGTCCCCGACGGCGTCAAGGTCGTGGGACGTGACACGACCGCTGCGGCGTCAGCTCAGCCTTGCAAGACCCCAGGCGCCCGCGCTGCACCTGCGACTGTCGCCGCCGCCGTCGCAGTCGGACCAACTGCTGGCAGAATCTTCGTCCGCACGGCCCCAGCTGGAGTTGCACTTGCGGCCGCAAGCCGCCAGGGGGCGCCGCAGAGCGCGTGCGCGCAACGGGGACCACTGTCCGCTCGGGCCCGGGCGTTGCTGCCGTCTGCACACGGTCCGCGCGTCGCTGGAAGACCTGGGCTGGGCCGATTGGGTGCTGTCGCCACGGGAGGTGCAAGTGACCATGTGCATCGGCGCGTGCCCGAGCCAGTTCCGGGCGGCAAACATGCACGCGCAGATCAAGACGAGCCTGCACCGCCTGAAGCCCGACACGGTGCCAGCGCCCTGCTGCGTGCCCGCCAGCTACAATCCCATGGTGCTCATTCAAAAGACCGACACCGGGGTGTCGCTCCAGACCTATGATGACTTGTTAGCCAAAGACTGCCACTGCATATGA
ORF Protein Sequence MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-451 Pre-Made Ponsegromab biosimilar, Whole mAb, Anti-GDF15 Antibody: Anti-GDF-15/MIC-1/MIC1/NAG-1/PDF/PLAB/PTGFB therapeutic antibody
    Target Antibody GM-Tg-g-T33245-Ab Anti-GDF15/ GDF-15/ MIC-1 functional antibody
    Target Antigen GM-Tg-g-T33245-Ag GDF15 protein
    Cytokine cks-Tg-g-GM-T33245 growth differentiation factor 15 (GDF15) protein & antibody
    ORF Viral Vector pGMLP000446 Human GDF15 Lentivirus plasmid
    ORF Viral Vector pGMPC001615 Human GDF15 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000446 Human GDF15 Lentivirus particle


    Target information

    Target ID GM-T33245
    Target Name GDF15
    Gene Group Identifier
    （Target Gene ID in Homo species)         		9518
    Gene ID 101086633 (Felis catus), 111769675 (Equus caballus), 23886 (Mus musculus), 29455 (Rattus norvegicus)
    484822 (Canis lupus familiaris), 618677 (Bos taurus), 719466 (Macaca mulatta), 9518 (Homo sapiens)
    Gene Symbols & Synonyms GDF15,Gdf15,SBF,MIC-1,NAG-1,HG,PDF,MIC1,PLAB,PTGFB,GDF-15
    Target Alternative Names GDF-15,GDF15,Gdf15,Growth/differentiation factor 15,HG,MIC-1,MIC1,Macrophage inhibitory cytokine 1 (MIC-1),NAG-1,NSAID-activated gene 1 protein (NAG-1),NSAID-regulated gene 1 protein (NRG-1),PDF,PLAB,PTGFB,Placental TGF-beta,Placental bone morphogenetic protein,Prostate differentiation factor,SBF
    Uniprot Accession Q99988,Q9Z0J6,Q9Z0J7
    Additional SwissProt Accessions: Q9Z0J7,Q9Z0J6,Q99988
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker, INN Index, Cytokine Target
    Disease cancer, Ovary Cancer
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSECAG00000039579, ENSMUSG00000038508, ENSCAFG00845022411, ENSBTAG00000015618, ENSMMUG00000050122, ENSG00000130513
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.