Human FKBP1A/FKBP-12/FKBP-1A ORF/cDNA clone-Lentivirus plasmid (NM_000801)

Cat. No.: pGMLP000449
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FKBP1A/FKBP-12/FKBP-1A Lentiviral expression plasmid for FKBP1A lentivirus packaging, FKBP1A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to FKBP1A/FKBP-12 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000449
Gene Name FKBP1A
Accession Number NM_000801
Gene ID 2280
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 327 bp
Gene Alias FKBP-12,FKBP-1A,FKBP1,FKBP12,PKC12,PKCI2,PPIASE
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGAGTGCAGGTGGAAACCATCTCCCCAGGAGACGGGCGCACCTTCCCCAAGCGCGGCCAGACCTGCGTGGTGCACTACACCGGGATGCTTGAAGATGGAAAGAAATTTGATTCCTCCCGGGACAGAAACAAGCCCTTTAAGTTTATGCTAGGCAAGCAGGAGGTGATCCGAGGCTGGGAAGAAGGGGTTGCCCAGATGAGTGTGGGTCAGAGAGCCAAACTGACTATATCTCCAGATTATGCCTATGGTGCCACTGGGCACCCAGGCATCATCCCACCACATGCCACTCTCGTCTTCGATGTGGAGCTTCTAAAACTGGAATGA
ORF Protein Sequence MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0019-Ab Anti-FKBP1A monoclonal antibody
    Target Antigen GM-Tg-g-IP0019-Ag FKBP1A protein
    ORF Viral Vector pGMLP000449 Human FKBP1A Lentivirus plasmid
    ORF Viral Vector pGMAP000355 Human FKBP1A Adenovirus plasmid
    ORF Viral Vector pGMAP000487 Human FKBP1A Adenovirus plasmid
    ORF Viral Vector vGMLP000449 Human FKBP1A Lentivirus particle
    ORF Viral Vector vGMAP000355 Human FKBP1A Adenovirus particle
    ORF Viral Vector vGMAP000487 Human FKBP1A Adenovirus particle


    Target information

    Target ID GM-IP0019
    Target Name FKBP1A
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2280
    Gene ID 100629541 (Equus caballus), 100686033 (Canis lupus familiaris), 101100379 (Felis catus), 14225 (Mus musculus)
    2280 (Homo sapiens), 25639 (Rattus norvegicus), 614795 (Bos taurus), 717385 (Macaca mulatta)
    Gene Symbols & Synonyms FKBP1A,Fkbp1a,Fkbp,Fkbp1,FKBP12,FKBP1,PKC12,PKCI2,PPIASE,FKBP-12,FKBP-1A,Fkbp2,FKBP1B
    Target Alternative Names 12 kDa FK506-binding protein (12 kDa FKBP,Calstabin-1,FK506-binding protein 1A (FKBP-1A),FKBP-12,FKBP-12),FKBP-1A,FKBP1,FKBP12,FKBP1A,FKBP1B,Fkbp,Fkbp1,Fkbp1a,Fkbp2,Immunophilin FKBP12,PKC12,PKCI2,PPIASE,PPIase FKBP1A,Peptidyl-prolyl cis-trans isomerase FKBP1A,Rotamase
    Uniprot Accession P18203,P26883,P62942,Q62658
    Additional SwissProt Accessions: P26883,P62942,Q62658,P18203
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000017887, ENSCAFG00845018977, ENSMUSG00000032966, ENSG00000088832, ENSBTAG00000008303, ENSMMUG00000015996
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.