Human SLPI/ALK1/ALP ORF/cDNA clone-Lentivirus plasmid (NM_003064)

Cat. No.: pGMLP000454
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SLPI/ALK1/ALP Lentiviral expression plasmid for SLPI lentivirus packaging, SLPI lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SLPI/ALK1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000454
Gene Name SLPI
Accession Number NM_003064
Gene ID 6590
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 399 bp
Gene Alias ALK1,ALP,BLPI,HUSI,HUSI-I,MPI,WAP4,WFDC4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGTCCAGCGGCCTCTTCCCCTTCCTGGTGCTGCTTGCCCTGGGAACTCTGGCACCTTGGGCTGTGGAAGGCTCTGGAAAGTCCTTCAAAGCTGGAGTCTGTCCTCCTAAGAAATCTGCCCAGTGCCTTAGATACAAGAAACCTGAGTGCCAGAGTGACTGGCAGTGTCCAGGGAAGAAGAGATGTTGTCCTGACACTTGTGGCATCAAATGCCTGGATCCTGTTGACACCCCAAACCCAACAAGGAGGAAGCCTGGGAAGTGCCCAGTGACTTATGGCCAATGTTTGATGCTTAACCCCCCCAATTTCTGTGAGATGGATGGCCAGTGCAAGCGTGACTTGAAGTGTTGCATGGGCATGTGTGGGAAATCCTGCGTTTCCCCTGTGAAAGCTTGA
ORF Protein Sequence MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1292-Ab Anti-SLPI/ ALK1/ ALP functional antibody
    Target Antigen GM-Tg-g-SE1292-Ag SLPI protein
    ORF Viral Vector pGMLP000454 Human SLPI Lentivirus plasmid
    ORF Viral Vector pGMAP000268 Human SLPI Adenovirus plasmid
    ORF Viral Vector vGMLP000454 Human SLPI Lentivirus particle
    ORF Viral Vector vGMAP000268 Human SLPI Adenovirus particle


    Target information

    Target ID GM-SE1292
    Target Name SLPI
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6590
    Gene ID 101090682 (Felis catus), 20568 (Mus musculus), 6590 (Homo sapiens), 711156 (Macaca mulatta)
    84386 (Rattus norvegicus)
    Gene Symbols & Synonyms SLPI,Slpi,ALP,MPI,ALK1,BLPI,HUSI,WAP4,WFDC4,HUSI-I
    Target Alternative Names ALK1,ALP,Antileukoproteinase,BLPI,HUSI,HUSI-1,HUSI-I,MPI,Mucus proteinase inhibitor (MPI),Protease inhibitor WAP4,SLPI,Secretory leukocyte protease inhibitor,Seminal proteinase inhibitor,Slpi,WAP four-disulfide core domain protein 4,WAP4,WFDC4
    Uniprot Accession P03973,P97430
    Additional SwissProt Accessions: P97430,P03973
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease cancer, Prostate Cancer
    Disease from KEGG
    Gene Ensembl ENSMUSG00000017002, ENSG00000124107, ENSMMUG00000050091
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.