Human IL3/IL-3/MCGF ORF/cDNA clone-Lentivirus plasmid (NM_000588)

Cat. No.: pGMLP000459
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL3/IL-3/MCGF Lentiviral expression plasmid for IL3 lentivirus packaging, IL3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-3/IL3/IL3/IL-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000459
Gene Name IL3
Accession Number NM_000588
Gene ID 3562
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 459 bp
Gene Alias IL-3,MCGF,MULTI-CSF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCCGCCTGCCCGTCCTGCTCCTGCTCCAACTCCTGGTCCGCCCCGGACTCCAAGCTCCCATGACCCAGACAACGCCCTTGAAGACAAGCTGGGTTAACTGCTCTAACATGATCGATGAAATTATAACACACTTAAAGCAGCCACCTTTGCCTTTGCTGGACTTCAACAACCTCAATGGGGAAGACCAAGACATTCTGATGGAAAATAACCTTCGAAGGCCAAACCTGGAGGCATTCAACAGGGCTGTCAAGAGTTTACAGAACGCATCAGCAATTGAGAGCATTCTTAAAAATCTCCTGCCATGTCTGCCCCTGGCCACGGCCGCACCCACGCGACATCCAATCCATATCAAGGACGGTGACTGGAATGAATTCCGGAGGAAACTGACGTTCTATCTGAAAACCCTTGAGAATGCGCAGGCTCAACAGACGACTTTGAGCCTCGCGATCTTTTGA
ORF Protein Sequence MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1027-Ab Anti-IL3/ IL-3/ MCGF functional antibody
    Target Antigen GM-Tg-g-SE1027-Ag IL3 protein
    ORF Viral Vector pGMLP000459 Human IL3 Lentivirus plasmid
    ORF Viral Vector pGMAP000287 Human IL3 Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-006 Human IL3 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-089 Human IL3 Adenovirus plasmid
    ORF Viral Vector vGMLP000459 Human IL3 Lentivirus particle
    ORF Viral Vector vGMAP000287 Human IL3 Adenovirus particle
    ORF Viral Vector vGMLP-IL-006 Human IL3 Lentivirus particle
    ORF Viral Vector vGMAP-IL-089 Human IL3 Adenovirus particle


    Target information

    Target ID GM-SE1027
    Target Name IL-3/IL3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3562
    Gene ID 16187 (Mus musculus), 24495 (Rattus norvegicus), 280823 (Bos taurus), 3562 (Homo sapiens)
    481497 (Canis lupus familiaris), 706946 (Macaca mulatta)
    Gene Symbols & Synonyms Il3,IL3,BPA,PSF,HCGF,Il-3,MCGF,Csfmu,IL-3,MULTI-CSF
    Target Alternative Names BPA,Csfmu,HCGF,Hematopoietic growth factor,IL-3,IL3,Il-3,Il3,Interleukin-3,MCGF,MULTI-CSF,Mast cell growth factor (MCGF),Multipotential colony-stimulating factor,P-cell-stimulating factor,PSF
    Uniprot Accession P01586,P04823,P08700,P25140,P49875,Q9BDX4
    Additional SwissProt Accessions: P01586,P04823,P49875,P08700,Q9BDX4,P25140
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, PI3K-Akt signaling pathway, Apoptosis, JAK-STAT signaling pathway, Hematopoietic cell lineage, Fc epsilon RI signaling pathway, Pathways in cancer, Acute myeloid leukemia, Asthma
    Gene Ensembl ENSMUSG00000018914, ENSBTAG00000002140, ENSG00000164399, ENSMMUG00000016912
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.