Human CD3D/CD3-DELTA/IMD19 ORF/cDNA clone-Lentivirus plasmid (NM_000732)

Cat. No.: pGMLP000460
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD3D/CD3-DELTA/IMD19 Lentiviral expression plasmid for CD3D lentivirus packaging, CD3D lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CD3 Delta/CD3D/CD3d/CD3D/CD3-DELTA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $429
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000460
Gene Name CD3D
Accession Number NM_000732
Gene ID 915
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 516 bp
Gene Alias CD3-DELTA,IMD19,T3D
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAACATAGCACGTTTCTCTCTGGCCTGGTACTGGCTACCCTTCTCTCGCAAGTGAGCCCCTTCAAGATACCTATAGAGGAACTTGAGGACAGAGTGTTTGTGAATTGCAATACCAGCATCACATGGGTAGAGGGAACGGTGGGAACACTGCTCTCAGACATTACAAGACTGGACCTGGGAAAACGCATCCTGGACCCACGAGGAATATATAGGTGTAATGGGACAGATATATACAAGGACAAAGAATCTACCGTGCAAGTTCATTATCGAATGTGCCAGAGCTGTGTGGAGCTGGATCCAGCCACCGTGGCTGGCATCATTGTCACTGATGTCATTGCCACTCTGCTCCTTGCTTTGGGAGTCTTCTGCTTTGCTGGACATGAGACTGGAAGGCTGTCTGGGGCTGCCGACACACAAGCTCTGTTGAGGAATGACCAGGTCTATCAGCCCCTCCGAGATCGAGATGATGCTCAGTACAGCCACCTTGGAGGAAACTGGGCTCGGAACAAGTGA
ORF Protein Sequence MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0211-Ab Anti-CD3D/ CD3-DELTA/ IMD19 monoclonal antibody
    Target Antigen GM-Tg-g-MP0211-Ag CD3D VLP (virus-like particle)
    ORF Viral Vector pGMLP000460 Human CD3D Lentivirus plasmid
    ORF Viral Vector pGMAP000294 Human CD3D Adenovirus plasmid
    ORF Viral Vector pGMPC001048 Human CD3D Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000460 Human CD3D Lentivirus particle
    ORF Viral Vector vGMAP000294 Human CD3D Adenovirus particle


    Target information

    Target ID GM-MP0211
    Target Name CD3 Delta/CD3D/CD3d
    Gene Group Identifier
    （Target Gene ID in Homo species)         		915
    Gene ID 100062931 (Equus caballus), 101083107 (Felis catus), 12500 (Mus musculus), 25710 (Rattus norvegicus)
    281053 (Bos taurus), 479419 (Canis lupus familiaris), 699582 (Macaca mulatta), 915 (Homo sapiens)
    Gene Symbols & Synonyms CD3D,Cd3d,T3d,T3D,IMD19,CD3DELTA,CD3-DELTA
    Target Alternative Names CD3 Delta,CD3-DELTA,CD3D,CD3DELTA,CD3d,Cd3d,IMD19,T-cell receptor T3 delta chain,T-cell surface glycoprotein CD3 delta chain,T3D,T3d
    Uniprot Accession P04234,P04235,P19377,Q28072
    Additional SwissProt Accessions: P04235,P19377,Q28072,P04234
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG Hematopoietic cell lineage, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Chagas disease, Measles, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection, PD-L1 expression and PD-1 checkpoint pathway in cancer
    Gene Ensembl ENSECAG00000018190, ENSMUSG00000032094, ENSBTAG00000006452, ENSCAFG00845002450, ENSMMUG00000049268, ENSG00000167286
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.