Human S100A8/60B8AG/CAGA ORF/cDNA clone-Lentivirus plasmid (NM_002964)

Cat. No.: pGMLP000464
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human S100A8/60B8AG/CAGA Lentiviral expression plasmid for S100A8 lentivirus packaging, S100A8 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to S100A8/60B8AG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000464
Gene Name S100A8
Accession Number NM_002964
Gene ID 6279
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 282 bp
Gene Alias 60B8AG,CAGA,CFAG,CGLA,CP-10,L1Ag,MA387,MIF,MRP8,NIF,P8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTGACCGAGCTGGAGAAAGCCTTGAACTCTATCATCGACGTCTACCACAAGTACTCCCTGATAAAGGGGAATTTCCATGCCGTCTACAGGGATGACCTGAAGAAATTGCTAGAGACCGAGTGTCCTCAGTATATCAGGAAAAAGGGTGCAGACGTCTGGTTCAAAGAGTTGGATATCAACACTGATGGTGCAGTTAACTTCCAGGAGTTCCTCATTCTGGTGATAAAGATGGGCGTGGCAGCCCACAAAAAAAGCCATGAAGAAAGCCACAAAGAGTAG
ORF Protein Sequence MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T27402-Ab Anti-S10A8/ S100A8/ 60B8AG monoclonal antibody
    Target Antigen GM-Tg-g-T27402-Ag S100A8 VLP (virus-like particle)
    ORF Viral Vector pGMLP000464 Human S100A8 Lentivirus plasmid
    ORF Viral Vector pGMLV000491 Human S100A8 Lentivirus plasmid
    ORF Viral Vector pGMLV000751 Human S100A8 Lentivirus plasmid
    ORF Viral Vector pGMAP000312 Human S100A8 Adenovirus plasmid
    ORF Viral Vector vGMLP000464 Human S100A8 Lentivirus particle
    ORF Viral Vector vGMLV000491 Human S100A8 Lentivirus particle
    ORF Viral Vector vGMLV000751 Human S100A8 Lentivirus particle
    ORF Viral Vector vGMAP000312 Human S100A8 Adenovirus particle


    Target information

    Target ID GM-T27402
    Target Name S100A8
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6279
    Gene ID 100061766 (Equus caballus), 101084164 (Felis catus), 116547 (Rattus norvegicus), 20201 (Mus musculus)
    490461 (Canis lupus familiaris), 616818 (Bos taurus), 6279 (Homo sapiens), 714740 (Macaca mulatta)
    Gene Symbols & Synonyms S100A8,S100a8,Mrp8,p8,B8Ag,CFAg,Caga,MRP8,CP-10,60B8Ag,P8,MIF,NIF,CAGA,CFAG,CGLA,L1Ag,MA387,60B8AG,S100-A8
    Target Alternative Names 60B8AG,60B8Ag,B8Ag,CAGA,CFAG,CFAg,CGLA,CP-10,Caga,Calgranulin-A,Calprotectin L1L subunit,Cystic fibrosis antigen (CFAG),L1Ag,Leukocyte L1 complex light chain,MA387,MIF,MRP8,Migration inhibitory factor-related protein 8 (MRP-8,Mrp8,NIF,P8,Protein S100-A8,S100 calcium-binding protein A8,S100-A8,S100A8,S100a8,Urinary stone protein band A,p8,p8)
    Uniprot Accession P05109,P27005,P28782,P50115
    Additional SwissProt Accessions: P50115,P27005,P28782,P05109
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Diagnostics Biomarker
    Disease cancer, Acute appendicitis, Congenital occlusion of ureteropelvic junction, Contact with and (suspected) exposure to environmental tobacco smoke (acute) (chronic), Malignant neoplasm of bladder
    Disease from KEGG IL-17 signaling pathway
    Gene Ensembl ENSMUSG00000056054, ENSCAFG00845002217, ENSG00000143546, ENSMMUG00000044778
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.