Human FGF18/FGF-18/ZFGF5 ORF/cDNA clone-Lentivirus plasmid (NM_003862)

Cat. No.: pGMLP000468
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FGF18/FGF-18/ZFGF5 Lentiviral expression plasmid for FGF18 lentivirus packaging, FGF18 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FGF18/FGF-18 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $456
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000468
Gene Name FGF18
Accession Number NM_003862
Gene ID 8817
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 624 bp
Gene Alias FGF-18,ZFGF5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTATTCAGCGCCCTCCGCCTGCACTTGCCTGTGTTTACACTTCCTGCTGCTGTGCTTCCAGGTACAGGTGCTGGTTGCCGAGGAGAACGTGGACTTCCGCATCCACGTGGAGAACCAGACGCGGGCTCGGGACGATGTGAGCCGTAAGCAGCTGCGGCTGTACCAGCTCTACAGCCGGACCAGTGGGAAACACATCCAGGTCCTGGGCCGCAGGATCAGTGCCCGCGGCGAGGATGGGGACAAGTATGCCCAGCTCCTAGTGGAGACAGACACCTTCGGTAGTCAAGTCCGGATCAAGGGCAAGGAGACGGAATTCTACCTGTGCATGAACCGCAAAGGCAAGCTCGTGGGGAAGCCCGATGGCACCAGCAAGGAGTGTGTGTTCATCGAGAAGGTTCTGGAGAACAACTACACGGCCCTGATGTCGGCTAAGTACTCCGGCTGGTACGTGGGCTTCACCAAGAAGGGGCGGCCGCGGAAGGGCCCCAAGACCCGGGAGAACCAGCAGGACGTGCATTTCATGAAGCGCTACCCCAAGGGGCAGCCGGAGCTTCAGAAGCCCTTCAAGTACACGACGGTGACCAAGAGGTCCCGTCGGATCCGGCCCACACACCCTGCCTAG
ORF Protein Sequence MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T99732-Ab Anti-FGF18/ FGF-18/ ZFGF5 functional antibody
    Target Antigen GM-Tg-g-T99732-Ag FGF18 protein
    Cytokine cks-Tg-g-GM-T99732 fibroblast growth factor 18 (FGF18) protein & antibody
    ORF Viral Vector pGMLP000468 Human FGF18 Lentivirus plasmid
    ORF Viral Vector pGMAP000362 Human FGF18 Adenovirus plasmid
    ORF Viral Vector vGMLP000468 Human FGF18 Lentivirus particle
    ORF Viral Vector vGMAP000362 Human FGF18 Adenovirus particle


    Target information

    Target ID GM-T99732
    Target Name FGF18
    Gene Group Identifier
    （Target Gene ID in Homo species)         		8817
    Gene ID 100629648 (Equus caballus), 101098518 (Felis catus), 14172 (Mus musculus), 29369 (Rattus norvegicus)
    533929 (Bos taurus), 611641 (Canis lupus familiaris), 702072 (Macaca mulatta), 8817 (Homo sapiens)
    Gene Symbols & Synonyms FGF18,Fgf18,Fgf6a,FGF-18,D130055P09Rik,FGF6A,ZFGF5
    Target Alternative Names D130055P09Rik,FGF-18,FGF18,FGF6A,Fgf18,Fgf6a,Fibroblast growth factor 18,ZFGF5,zFGF5
    Uniprot Accession O76093,O88182,O89101,Q0VCA0
    Additional SwissProt Accessions: O89101,O88182,Q0VCA0,O76093
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease Breast Cancer
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer
    Gene Ensembl ENSECAG00000030850, ENSMUSG00000057967, ENSBTAG00000000128, ENSCAFG00845001658, ENSMMUG00000019401, ENSG00000156427
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.