Human FGF18/FGF-18/ZFGF5 ORF/cDNA clone-Lentivirus plasmid (NM_003862)
Cat. No.: pGMLP000468
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FGF18/FGF-18/ZFGF5 Lentiviral expression plasmid for FGF18 lentivirus packaging, FGF18 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
FGF18/FGF-18 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000468 |
| Gene Name | FGF18 |
| Accession Number | NM_003862 |
| Gene ID | 8817 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 624 bp |
| Gene Alias | FGF-18,ZFGF5 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTATTCAGCGCCCTCCGCCTGCACTTGCCTGTGTTTACACTTCCTGCTGCTGTGCTTCCAGGTACAGGTGCTGGTTGCCGAGGAGAACGTGGACTTCCGCATCCACGTGGAGAACCAGACGCGGGCTCGGGACGATGTGAGCCGTAAGCAGCTGCGGCTGTACCAGCTCTACAGCCGGACCAGTGGGAAACACATCCAGGTCCTGGGCCGCAGGATCAGTGCCCGCGGCGAGGATGGGGACAAGTATGCCCAGCTCCTAGTGGAGACAGACACCTTCGGTAGTCAAGTCCGGATCAAGGGCAAGGAGACGGAATTCTACCTGTGCATGAACCGCAAAGGCAAGCTCGTGGGGAAGCCCGATGGCACCAGCAAGGAGTGTGTGTTCATCGAGAAGGTTCTGGAGAACAACTACACGGCCCTGATGTCGGCTAAGTACTCCGGCTGGTACGTGGGCTTCACCAAGAAGGGGCGGCCGCGGAAGGGCCCCAAGACCCGGGAGAACCAGCAGGACGTGCATTTCATGAAGCGCTACCCCAAGGGGCAGCCGGAGCTTCAGAAGCCCTTCAAGTACACGACGGTGACCAAGAGGTCCCGTCGGATCCGGCCCACACACCCTGCCTAG |
| ORF Protein Sequence | MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T99732-Ab | Anti-FGF18/ FGF-18/ ZFGF5 functional antibody |
| Target Antigen | GM-Tg-g-T99732-Ag | FGF18 protein |
| Cytokine | cks-Tg-g-GM-T99732 | fibroblast growth factor 18 (FGF18) protein & antibody |
| ORF Viral Vector | pGMLP000468 | Human FGF18 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000362 | Human FGF18 Adenovirus plasmid |
| ORF Viral Vector | vGMLP000468 | Human FGF18 Lentivirus particle |
| ORF Viral Vector | vGMAP000362 | Human FGF18 Adenovirus particle |
Target information
| Target ID | GM-T99732 |
| Target Name | FGF18 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
8817 |
| Gene ID |
100629648 (Equus caballus), 101098518 (Felis catus), 14172 (Mus musculus), 29369 (Rattus norvegicus) 533929 (Bos taurus), 611641 (Canis lupus familiaris), 702072 (Macaca mulatta), 8817 (Homo sapiens) |
| Gene Symbols & Synonyms | FGF18,Fgf18,Fgf6a,FGF-18,D130055P09Rik,FGF6A,ZFGF5 |
| Target Alternative Names | D130055P09Rik,FGF-18,FGF18,FGF6A,Fgf18,Fgf6a,Fibroblast growth factor 18,ZFGF5,zFGF5 |
| Uniprot Accession |
O76093,O88182,O89101,Q0VCA0
Additional SwissProt Accessions: O89101,O88182,Q0VCA0,O76093 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | Breast Cancer |
| Disease from KEGG | MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer |
| Gene Ensembl | ENSECAG00000030850, ENSMUSG00000057967, ENSBTAG00000000128, ENSCAFG00845001658, ENSMMUG00000019401, ENSG00000156427 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


