Human AKR1B1/ADR/ALDR1 ORF/cDNA clone-Lentivirus plasmid (NM_001628)

Cat. No.: pGMLP000471
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human AKR1B1/ADR/ALDR1 Lentiviral expression plasmid for AKR1B1 lentivirus packaging, AKR1B1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to AKR1B1/ADR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $537.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000471
Gene Name AKR1B1
Accession Number NM_001628
Gene ID 231
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 951 bp
Gene Alias ADR,ALDR1,ALR2,AR
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAAGCCGTCTCCTGCTCAACAACGGCGCCAAGATGCCCATCCTGGGGTTGGGTACCTGGAAGTCCCCTCCAGGGCAGGTGACTGAGGCCGTGAAGGTGGCCATTGACGTCGGGTACCGCCACATCGACTGTGCCCATGTGTACCAGAATGAGAATGAGGTGGGGGTGGCCATTCAGGAGAAGCTCAGGGAGCAGGTGGTGAAGCGTGAGGAGCTCTTCATCGTCAGCAAGCTGTGGTGCACGTACCATGAGAAGGGCCTGGTGAAAGGAGCCTGCCAGAAGACACTCAGCGACCTGAAGCTGGACTACCTGGACCTCTACCTTATTCACTGGCCGACTGGCTTTAAGCCTGGGAAGGAATTTTTCCCATTGGATGAGTCGGGCAATGTGGTTCCCAGTGACACCAACATTCTGGACACGTGGGCGGCCATGGAAGAGCTGGTGGATGAAGGGCTGGTGAAAGCTATTGGCATCTCCAACTTCAACCATCTCCAGGTGGAGATGATCTTAAACAAACCTGGCTTGAAGTATAAGCCTGCAGTTAACCAGATTGAGTGCCACCCATATCTCACTCAGGAGAAGTTAATCCAGTACTGCCAGTCCAAAGGCATCGTGGTGACCGCCTACAGCCCCCTCGGCTCTCCTGACAGGCCCTGGGCCAAGCCCGAGGACCCTTCTCTCCTGGAGGATCCCAGGATCAAGGCGATCGCAGCCAAGCACAATAAAACTACAGCCCAGGTCCTGATCCGGTTCCCCATGCAGAGGAACTTGGTGGTGATCCCCAAGTCTGTGACACCAGAACGCATTGCTGAGAACTTTAAGGTCTTTGACTTTGAACTGAGCAGCCAGGATATGACCACCTTACTCAGCTACAACAGGAACTGGAGGGTCTGTGCCTTGTTGAGCTGTACCTCCCACAAGGATTACCCCTTCCATGAAGAGTTTTGA
ORF Protein Sequence MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T26623-Ab Anti-AKR1B1 monoclonal antibody
    Target Antigen GM-Tg-g-T26623-Ag AKR1B1 protein
    ORF Viral Vector pGMLP000471 Human AKR1B1 Lentivirus plasmid
    ORF Viral Vector pGMAP000366 Human AKR1B1 Adenovirus plasmid
    ORF Viral Vector vGMLP000471 Human AKR1B1 Lentivirus particle
    ORF Viral Vector vGMAP000366 Human AKR1B1 Adenovirus particle


    Target information

    Target ID GM-T26623
    Target Name AKR1B1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		231
    Gene ID 100065145 (Equus caballus), 101095406 (Felis catus), 11677 (Mus musculus), 231 (Homo sapiens)
    24192 (Rattus norvegicus), 607537 (Canis lupus familiaris)
    Gene Symbols & Synonyms AKR1B1,Akr1b1,AR,ALR2,Ahr1,Ahr-1,Aldr1,Akr1b3,Aldor1,ADR,ALDR1,Alr,ALDRED,Akr1b4,ALR-P-I,RATALDRED
    Target Alternative Names ADR,AKR1B1,ALDR1,ALDRED,ALR-P-I,ALR2,AR,Ahr-1,Ahr1,Akr1b1,Akr1b3,Akr1b4,Aldehyde reductase,Aldo-keto reductase family 1 member B1,Aldor1,Aldose reductase (AR),Aldr1,Alr,RATALDRED
    Uniprot Accession P07943,P15121,P45376
    Additional SwissProt Accessions: P45376,P15121,P07943
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Breast Cancer
    Disease from KEGG Metabolic pathways, Pentose and glucuronate interconversions
    Gene Ensembl ENSECAG00000014271, ENSMUSG00000001642, ENSG00000085662, ENSCAFG00845014537
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.