Human CNTF/HCNTF ORF/cDNA clone-Lentivirus plasmid (NM_000614)

Cat. No.: pGMLP000479
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CNTF/HCNTF Lentiviral expression plasmid for CNTF lentivirus packaging, CNTF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CNTF/HCNTF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000479
Gene Name CNTF
Accession Number NM_000614
Gene ID 1270
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 603 bp
Gene Alias HCNTF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTTCACAGAGCATTCACCGCTGACCCCTCACCGTCGGGACCTCTGTAGCCGCTCTATCTGGCTAGCAAGGAAGATTCGTTCAGACCTGACTGCTCTTACGGAATCCTATGTGAAGCATCAGGGCCTGAACAAGAACATCAACCTGGACTCTGCGGATGGGATGCCAGTGGCAAGCACTGATCAGTGGAGTGAGCTGACCGAGGCAGAGCGACTCCAAGAGAACCTTCAAGCTTATCGTACCTTCCATGTTTTGTTGGCCAGGCTCTTAGAAGACCAGCAGGTGCATTTTACCCCAACCGAAGGTGACTTCCATCAAGCTATACATACCCTTCTTCTCCAAGTCGCTGCCTTTGCATACCAGATAGAGGAGTTAATGATACTCCTGGAATACAAGATCCCCCGCAATGAGGCTGATGGGATGCCTATTAATGTTGGAGATGGTGGTCTCTTTGAGAAGAAGCTGTGGGGCCTAAAGGTGCTGCAGGAGCTTTCACAGTGGACAGTAAGGTCCATCCATGACCTTCGTTTCATTTCTTCTCATCAGACTGGGATCCCAGCACGTGGGAGCCATTATATTGCTAACAACAAGAAAATGTAG
ORF Protein Sequence MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T83192-Ab Anti-CNTF monoclonal antibody
    Target Antigen GM-Tg-g-T83192-Ag CNTF protein
    Cytokine cks-Tg-g-GM-T83192 ciliary neurotrophic factor (CNTF) protein & antibody
    ORF Viral Vector pGMLP000479 Human CNTF Lentivirus plasmid
    ORF Viral Vector pGMAP000377 Human CNTF Adenovirus plasmid
    ORF Viral Vector vGMLP000479 Human CNTF Lentivirus particle
    ORF Viral Vector vGMAP000377 Human CNTF Adenovirus particle


    Target information

    Target ID GM-T83192
    Target Name CNTF
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1270
    Gene ID 100629778 (Equus caballus), 100848228 (Bos taurus), 101097592 (Felis catus), 1270 (Homo sapiens)
    12803 (Mus musculus), 25707 (Rattus norvegicus), 483464 (Canis lupus familiaris), 701907 (Macaca mulatta)
    Gene Symbols & Synonyms CNTF,Cntf,HCNTF
    Target Alternative Names CNTF,Ciliary neurotrophic factor,Cntf,HCNTF
    Uniprot Accession P20294,P26441,P51642
    Additional SwissProt Accessions: P26441,P51642,P20294
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target, Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway
    Gene Ensembl ENSBTAG00000003624, ENSG00000242689, ENSMUSG00000079415, ENSCAFG00845018289
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.