Human IL15/IL-15 ORF/cDNA clone-Lentivirus plasmid (NM_000585)

Cat. No.: pGMLP000483
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL15/IL-15 Lentiviral expression plasmid for IL15 lentivirus packaging, IL15 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IL-15/IL15/IL15/IL-15 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000483
Gene Name IL15
Accession Number NM_000585
Gene ID 3600
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 489 bp
Gene Alias IL-15
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGAATTTCGAAACCACATTTGAGAAGTATTTCCATCCAGTGCTACTTGTGTTTACTTCTAAACAGTCATTTTCTAACTGAAGCTGGCATTCATGTCTTCATTTTGGGCTGTTTCAGTGCAGGGCTTCCTAAAACAGAAGCCAACTGGGTGAATGTAATAAGTGATTTGAAAAAAATTGAAGATCTTATTCAATCTATGCATATTGATGCTACTTTATATACGGAAAGTGATGTTCACCCCAGTTGCAAAGTAACAGCAATGAAGTGCTTTCTCTTGGAGTTACAAGTTATTTCACTTGAGTCCGGAGATGCAAGTATTCATGATACAGTAGAAAATCTGATCATCCTAGCAAACAACAGTTTGTCTTCTAATGGGAATGTAACAGAATCTGGATGCAAAGAATGTGAGGAACTGGAGGAAAAAAATATTAAAGAATTTTTGCAGAGTTTTGTACATATTGTCCAAATGTTCATCAACACTTCTTGA
ORF Protein Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-864 Pre-Made Inbakicept biosimilar, Fusion Protein: Recombinant therapeutic protein targeting IL15 fused with human IGHG1 Fc (Fragment constant)
    Biosimilar GMP-Bios-ab-410 Pre-Made Ordesekimab biosimilar, Whole Mab: Anti-IL15 therapeutic antibody
    Target Antibody GM-Tg-g-T32240-Ab Anti-IL15/ IL-15 functional antibody
    Target Antigen GM-Tg-g-T32240-Ag IL15 protein
    ORF Viral Vector pGMLP000483 Human IL15 Lentivirus plasmid
    ORF Viral Vector pGMLV001105 Human IL15 Lentivirus plasmid
    ORF Viral Vector pGMAP000344 Human IL15 Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-018 Human IL15 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-101 Human IL15 Adenovirus plasmid
    ORF Viral Vector vGMLP000483 Human IL15 Lentivirus particle
    ORF Viral Vector vGMLV001105 Human IL15 Lentivirus particle
    ORF Viral Vector vGMAP000344 Human IL15 Adenovirus particle
    ORF Viral Vector vGMLP-IL-018 Human IL15 Lentivirus particle
    ORF Viral Vector vGMAP-IL-101 Human IL15 Adenovirus particle


    Target information

    Target ID GM-T32240
    Target Name IL-15/IL15
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3600
    Gene ID 100034058 (Equus caballus), 16168 (Mus musculus), 25670 (Rattus norvegicus), 281248 (Bos taurus)
    3600 (Homo sapiens), 403584 (Canis lupus familiaris), 493682 (Felis catus), 699616 (Macaca mulatta)
    Gene Symbols & Synonyms IL15,Il15,IL-15
    Target Alternative Names IL-15,IL15,Il15,Interleukin-15
    Uniprot Accession O97687,P40933,P48092,P48346,P97604,Q28028
    Additional SwissProt Accessions: P48346,P97604,Q28028,P40933,O97687,P48092
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway, TNF signaling pathway, Intestinal immune network for IgA production, Human T-cell leukemia virus 1 infection, Pathways in cancer, Rheumatoid arthritis
    Gene Ensembl ENSECAG00000014406, ENSMUSG00000031712, ENSBTAG00000018200, ENSG00000164136, ENSCAFG00845019627, ENSMMUG00000019092
    Target Classification Cytokine Receptor, Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.