Human LAT/IMD52/LAT1 ORF/cDNA clone-Lentivirus plasmid (NM_001014987)

Cat. No.: pGMLP000495
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LAT/IMD52/LAT1 Lentiviral expression plasmid for LAT lentivirus packaging, LAT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to LAT/IMD52 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $475.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000495
Gene Name LAT
Accession Number NM_001014987
Gene ID 27040
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 702 bp
Gene Alias IMD52,LAT1,pp36
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGAGGCCATCCTGGTCCCCTGCGTGCTGGGGCTCCTGCTGCTGCCCATCCTGGCCATGTTGATGGCACTGTGTGTGCACTGCCACAGACTGCCAGGCTCCTACGACAGCACATCCTCAGATAGTTTGTATCCAAGGGGCATCCAGTTCAAACGGCCTCACACGGTTGCCCCCTGGCCACCTGCCTACCCACCTGTCACCTCCTACCCACCCCTGAGCCAGCCAGACCTGCTCCCCATCCCAAGATCCCCGCAGCCCCTTGGGGGCTCCCACCGGACGCCATCTTCCCGGCGGGATTCTGATGGTGCCAACAGTGTGGCGAGCTACGAGAACGAGGAACCAGCCTGTGAGGATGCGGATGAGGATGAGGACGACTATCACAACCCAGGCTACCTGGTGGTGCTTCCTGACAGCACCCCGGCCACTAGCACTGCTGCCCCATCAGCTCCTGCACTCAGCACCCCTGGCATCCGAGACAGTGCCTTCTCCATGGAGTCCATTGATGATTACGTGAACGTTCCGGAGAGCGGGGAGAGCGCAGAAGCGTCTCTGGATGGCAGCCGGGAGTATGTGAATGTGTCCCAGGAACTGCATCCTGGAGCGGCTAAGACTGAGCCTGCCGCCCTGAGTTCCCAGGAGGCAGAGGAAGTGGAGGAAGAGGGGGCTCCAGATTACGAGAATCTGCAGGAGCTGAACTGA
ORF Protein Sequence MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0722-Ab Anti-LAT/ IMD521/ pp36 monoclonal antibody
    Target Antigen GM-Tg-g-MP0722-Ag LAT VLP (virus-like particle)
    ORF Viral Vector pGMLP000495 Human LAT Lentivirus plasmid
    ORF Viral Vector pGMAP000058 Human LAT Adenovirus plasmid
    ORF Viral Vector vGMLP000495 Human LAT Lentivirus particle
    ORF Viral Vector vGMAP000058 Human LAT Adenovirus particle


    Target information

    Target ID GM-MP0722
    Target Name LAT
    Gene Group Identifier
    （Target Gene ID in Homo species)         		27040
    Gene ID 100064430 (Equus caballus), 101093319 (Felis catus), 16797 (Mus musculus), 27040 (Homo sapiens)
    514735 (Bos taurus), 607947 (Canis lupus familiaris), 704656 (Macaca mulatta), 81511 (Rattus norvegicus)
    Gene Symbols & Synonyms LAT,Lat,pp36,p36-38,LAT1,IMD52
    Target Alternative Names 36 kDa phosphotyrosine adapter protein (pp36),IMD52,LAT,LAT1,Lat,Linker for activation of T-cells family member 1,p36-38,pp36
    Uniprot Accession O43561,O54957,O70601
    Additional SwissProt Accessions: O54957,O43561,O70601
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Ras signaling pathway, Rap1 signaling pathway, NF-kappa B signaling pathway, Natural killer cell mediated cytotoxicity, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Fc epsilon RI signaling pathway, Yersinia infection, PD-L1 expression and PD-1 checkpoint pathway in cancer
    Gene Ensembl ENSECAG00000021184, ENSMUSG00000030742, ENSG00000213658, ENSBTAG00000021249, ENSCAFG00845003673, ENSMMUG00000043332
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.