Human LGALS3/CBP35/GAL3 ORF/cDNA clone-Lentivirus plasmid (NM_002306)

Cat. No.: pGMLP000501
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LGALS3/CBP35/GAL3 Lentiviral expression plasmid for LGALS3 lentivirus packaging, LGALS3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to Galectin-3/Galectin 3/LGALS3/LGALS3/CBP35 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $488.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000501
Gene Name LGALS3
Accession Number NM_002306
Gene ID 3958
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 753 bp
Gene Alias CBP35,GAL3,GALBP,GALIG,L31,LGALS2,MAC2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGACAATTTTTCGCTCCATGATGCGTTATCTGGGTCTGGAAACCCAAACCCTCAAGGATGGCCTGGCGCATGGGGGAACCAGCCTGCTGGGGCAGGGGGCTACCCAGGGGCTTCCTATCCTGGGGCCTACCCCGGGCAGGCACCCCCAGGGGCTTATCCTGGACAGGCACCTCCAGGCGCCTACCCTGGAGCACCTGGAGCTTATCCCGGAGCACCTGCACCTGGAGTCTACCCAGGGCCACCCAGCGGCCCTGGGGCCTACCCATCTTCTGGACAGCCAAGTGCCACCGGAGCCTACCCTGCCACTGGCCCCTATGGCGCCCCTGCTGGGCCACTGATTGTGCCTTATAACCTGCCTTTGCCTGGGGGAGTGGTGCCTCGCATGCTGATAACAATTCTGGGCACGGTGAAGCCCAATGCAAACAGAATTGCTTTAGATTTCCAAAGAGGGAATGATGTTGCCTTCCACTTTAACCCACGCTTCAATGAGAACAACAGGAGAGTCATTGTTTGCAATACAAAGCTGGATAATAACTGGGGAAGGGAAGAAAGACAGTCGGTTTTCCCATTTGAAAGTGGGAAACCATTCAAAATACAAGTACTGGTTGAACCTGACCACTTCAAGGTTGCAGTGAATGATGCTCACTTGTTGCAGTACAATCATCGGGTTAAAAAACTCAATGAAATCAGCAAACTGGGAATTTCTGGTGACATAGACCTCACCAGTGCTTCATATACCATGATATAA
ORF Protein Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T72038-Ab Anti-LEG3/ LGALS3/ CBP35 monoclonal antibody
    Target Antigen GM-Tg-g-T72038-Ag LGALS3 VLP (virus-like particle)
    ORF Viral Vector pGMLP000501 Human LGALS3 Lentivirus plasmid
    ORF Viral Vector pGMLV001314 Human LGALS3 Lentivirus plasmid
    ORF Viral Vector pGMLV002196 Human LGALS3 Lentivirus plasmid
    ORF Viral Vector pGMLV002276 Human LGALS3 Lentivirus plasmid
    ORF Viral Vector pGMAP000432 Human LGALS3 Adenovirus plasmid
    ORF Viral Vector pGMPC000875 Human LGALS3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001102 Human LGALS3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000501 Human LGALS3 Lentivirus particle
    ORF Viral Vector vGMLV001314 Human LGALS3 Lentivirus particle
    ORF Viral Vector vGMLV002196 Human LGALS3 Lentivirus particle
    ORF Viral Vector vGMLV002276 Human LGALS3 Lentivirus particle
    ORF Viral Vector vGMAP000432 Human LGALS3 Adenovirus particle


    Target information

    Target ID GM-T72038
    Target Name Galectin-3/Galectin 3/LGALS3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3958
    Gene ID 100050367 (Equus caballus), 101081472 (Felis catus), 16854 (Mus musculus), 3958 (Homo sapiens)
    404021 (Canis lupus familiaris), 697290 (Macaca mulatta), 786492 (Bos taurus), 83781 (Rattus norvegicus)
    Gene Symbols & Synonyms LGALS3,Lgals3,galectin-3,GBP,L-34,gal3,Mac-2,L31,GAL3,MAC2,CBP35,GALBP,GALIG,LGALS2,Gal-3,CBP 35,Galectin-3,CBP30,gal-3,AGE-R3
    Target Alternative Names 35 kDa lectin,AGE-R3,CBP 35,CBP30,CBP35,Carbohydrate-binding protein 35 (CBP 35),GAL3,GALBP,GALIG,GBP,Gal-3,Galactose-specific lectin 3,Galactoside-binding protein (GALBP),Galectin 3,Galectin-3,IgE-binding protein,L-31,L-34,L31,LGALS2,LGALS3,Laminin-binding protein,Lectin L-29,Lgals3,MAC2,Mac-2,Mac-2 antigen,gal-3,gal3,galectin-3
    Uniprot Accession P08699,P16110,P17931,P38486
    Additional SwissProt Accessions: P16110,P17931,P38486,P08699
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000006474, ENSMUSG00000050335, ENSG00000131981, ENSCAFG00845015017, ENSMMUG00000003565, ENSBTAG00000002326
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.