Human GADD45G/CR6/DDIT2 ORF/cDNA clone-Lentivirus plasmid (NM_006705)
Cat. No.: pGMLP000504
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human GADD45G/CR6/DDIT2 Lentiviral expression plasmid for GADD45G lentivirus packaging, GADD45G lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
GADD45G/CR6 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000504 |
| Gene Name | GADD45G |
| Accession Number | NM_006705 |
| Gene ID | 10912 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 480 bp |
| Gene Alias | CR6,DDIT2,GADD45gamma,GRP17 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGACTCTGGAAGAAGTCCGCGGCCAGGACACAGTTCCGGAAAGCACAGCCAGGATGCAGGGTGCCGGGAAAGCGCTGCATGAGTTGCTGCTGTCGGCGCAGCGTCAGGGCTGCCTCACTGCCGGCGTCTACGAGTCAGCCAAAGTCTTGAACGTGGACCCCGACAATGTGACCTTCTGTGTGCTGGCTGCGGGTGAGGAGGACGAGGGCGACATCGCGCTGCAGATCCATTTTACGCTGATCCAGGCTTTCTGCTGCGAGAACGACATCGACATAGTGCGCGTGGGCGATGTGCAGCGGCTGGCGGCTATCGTGGGCGCCGGCGAGGAGGCGGGTGCGCCGGGCGACCTGCACTGCATCCTCATTTCGAACCCCAACGAGGACGCCTGGAAGGATCCCGCCTTGGAGAAGCTCAGCCTGTTTTGCGAGGAGAGCCGCAGCGTTAACGACTGGGTGCCCAGCATCACCCTCCCCGAGTGA |
| ORF Protein Sequence | MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-TA138-Ab | Anti-GADD45G monoclonal antibody |
| Target Antigen | GM-Tg-g-TA138-Ag | GADD45G protein |
| ORF Viral Vector | pGMLP000504 | Human GADD45G Lentivirus plasmid |
| ORF Viral Vector | pGMLV000185 | Human GADD45G Lentivirus plasmid |
| ORF Viral Vector | pGMLV000519 | Human GADD45G Lentivirus plasmid |
| ORF Viral Vector | pGMAP000097 | Human GADD45G Adenovirus plasmid |
| ORF Viral Vector | vGMLP000504 | Human GADD45G Lentivirus particle |
| ORF Viral Vector | vGMLV000185 | Human GADD45G Lentivirus particle |
| ORF Viral Vector | vGMLV000519 | Human GADD45G Lentivirus particle |
| ORF Viral Vector | vGMAP000097 | Human GADD45G Adenovirus particle |
Target information
| Target ID | GM-TA138 |
| Target Name | GADD45G |
|
Gene Group Identifier (Target Gene ID in Homo species) |
10912 |
| Gene ID |
100054996 (Equus caballus), 101086509 (Felis catus), 10912 (Homo sapiens), 23882 (Mus musculus) 291005 (Rattus norvegicus), 484198 (Canis lupus familiaris), 504939 (Bos taurus), 697835 (Macaca mulatta) |
| Gene Symbols & Synonyms | GADD45G,Gadd45g,CR6,DDIT2,GRP17,GADD45gamma,OIG37 |
| Target Alternative Names | CR6,Cytokine-responsive protein CR6,DDIT2,DNA damage-inducible transcript 2 protein (DDIT-2),GADD45G,GADD45gamma,GRP17,Gadd45g,Growth arrest and DNA damage-inducible protein GADD45 gamma,OIG37 |
| Uniprot Accession |
O95257,Q2KIX1,Q9WTQ7,Q9Z111
Additional SwissProt Accessions: O95257,Q9Z111,Q9WTQ7,Q2KIX1 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | |
| Disease from KEGG | MAPK signaling pathway, NF-kappa B signaling pathway, FoxO signaling pathway, p53 signaling pathway, Apoptosis, Cellular senescence, Epstein-Barr virus infection, Pathways in cancer, Colorectal cancer, Pancreatic cancer, Endometrial cancer, Glioma, Thyroid cancer, Basal cell carcinoma, Melanoma, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma, Gastric cancer |
| Gene Ensembl | ENSG00000130222, ENSMUSG00000021453, ENSCAFG00845018559, ENSMMUG00000048737 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


