Human GADD45G/CR6/DDIT2 ORF/cDNA clone-Lentivirus plasmid (NM_006705)

Cat. No.: pGMLP000504
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GADD45G/CR6/DDIT2 Lentiviral expression plasmid for GADD45G lentivirus packaging, GADD45G lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GADD45G/CR6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000504
Gene Name GADD45G
Accession Number NM_006705
Gene ID 10912
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 480 bp
Gene Alias CR6,DDIT2,GADD45gamma,GRP17
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTCTGGAAGAAGTCCGCGGCCAGGACACAGTTCCGGAAAGCACAGCCAGGATGCAGGGTGCCGGGAAAGCGCTGCATGAGTTGCTGCTGTCGGCGCAGCGTCAGGGCTGCCTCACTGCCGGCGTCTACGAGTCAGCCAAAGTCTTGAACGTGGACCCCGACAATGTGACCTTCTGTGTGCTGGCTGCGGGTGAGGAGGACGAGGGCGACATCGCGCTGCAGATCCATTTTACGCTGATCCAGGCTTTCTGCTGCGAGAACGACATCGACATAGTGCGCGTGGGCGATGTGCAGCGGCTGGCGGCTATCGTGGGCGCCGGCGAGGAGGCGGGTGCGCCGGGCGACCTGCACTGCATCCTCATTTCGAACCCCAACGAGGACGCCTGGAAGGATCCCGCCTTGGAGAAGCTCAGCCTGTTTTGCGAGGAGAGCCGCAGCGTTAACGACTGGGTGCCCAGCATCACCCTCCCCGAGTGA
ORF Protein Sequence MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA138-Ab Anti-GADD45G monoclonal antibody
    Target Antigen GM-Tg-g-TA138-Ag GADD45G protein
    ORF Viral Vector pGMLP000504 Human GADD45G Lentivirus plasmid
    ORF Viral Vector pGMLV000185 Human GADD45G Lentivirus plasmid
    ORF Viral Vector pGMLV000519 Human GADD45G Lentivirus plasmid
    ORF Viral Vector pGMAP000097 Human GADD45G Adenovirus plasmid
    ORF Viral Vector vGMLP000504 Human GADD45G Lentivirus particle
    ORF Viral Vector vGMLV000185 Human GADD45G Lentivirus particle
    ORF Viral Vector vGMLV000519 Human GADD45G Lentivirus particle
    ORF Viral Vector vGMAP000097 Human GADD45G Adenovirus particle


    Target information

    Target ID GM-TA138
    Target Name GADD45G
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10912
    Gene ID 100054996 (Equus caballus), 101086509 (Felis catus), 10912 (Homo sapiens), 23882 (Mus musculus)
    291005 (Rattus norvegicus), 484198 (Canis lupus familiaris), 504939 (Bos taurus), 697835 (Macaca mulatta)
    Gene Symbols & Synonyms GADD45G,Gadd45g,CR6,DDIT2,GRP17,GADD45gamma,OIG37
    Target Alternative Names CR6,Cytokine-responsive protein CR6,DDIT2,DNA damage-inducible transcript 2 protein (DDIT-2),GADD45G,GADD45gamma,GRP17,Gadd45g,Growth arrest and DNA damage-inducible protein GADD45 gamma,OIG37
    Uniprot Accession O95257,Q2KIX1,Q9WTQ7,Q9Z111
    Additional SwissProt Accessions: O95257,Q9Z111,Q9WTQ7,Q2KIX1
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG MAPK signaling pathway, NF-kappa B signaling pathway, FoxO signaling pathway, p53 signaling pathway, Apoptosis, Cellular senescence, Epstein-Barr virus infection, Pathways in cancer, Colorectal cancer, Pancreatic cancer, Endometrial cancer, Glioma, Thyroid cancer, Basal cell carcinoma, Melanoma, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma, Gastric cancer
    Gene Ensembl ENSG00000130222, ENSMUSG00000021453, ENSCAFG00845018559, ENSMMUG00000048737
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.