Human NME1/AWD/GAAD ORF/cDNA clone-Lentivirus plasmid (NM_000269)

Cat. No.: pGMLP000505
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NME1/AWD/GAAD Lentiviral expression plasmid for NME1 lentivirus packaging, NME1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NME1/NM23-H1/NME1/AWD products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000505
Gene Name NME1
Accession Number NM_000269
Gene ID 4830
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 459 bp
Gene Alias AWD,GAAD,NB,NBS,NDKA,NDPK-A,NDPKA,NM23,NM23-H1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCAACTGTGAGCGTACCTTCATTGCGATCAAACCAGATGGGGTCCAGCGGGGTCTTGTGGGAGAGATTATCAAGCGTTTTGAGCAGAAAGGATTCCGCCTTGTTGGTCTGAAATTCATGCAAGCTTCCGAAGATCTTCTCAAGGAACACTACGTTGACCTGAAGGACCGTCCATTCTTTGCCGGCCTGGTGAAATACATGCACTCAGGGCCGGTAGTTGCCATGGTCTGGGAGGGGCTGAATGTGGTGAAGACGGGCCGAGTCATGCTCGGGGAGACCAACCCTGCAGACTCCAAGCCTGGGACCATCCGTGGAGACTTCTGCATACAAGTTGGCAGGAACATTATACATGGCAGTGATTCTGTGGAGAGTGCAGAGAAGGAGATCGGCTTGTGGTTTCACCCTGAGGAACTGGTAGATTACACGAGCTGTGCTCAGAACTGGATCTATGAATGA
ORF Protein Sequence MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T42533-Ab Anti-NDKA/ NM23-H1/ NME1 functional antibody
    Target Antigen GM-Tg-g-T42533-Ag NM23-H1/NME1 protein
    ORF Viral Vector pGMLP000505 Human NME1 Lentivirus plasmid
    ORF Viral Vector pGMAP000091 Human NME1 Adenovirus plasmid
    ORF Viral Vector vGMLP000505 Human NME1 Lentivirus particle
    ORF Viral Vector vGMAP000091 Human NME1 Adenovirus particle


    Target information

    Target ID GM-T42533
    Target Name NME1/NM23-H1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4830
    Gene ID 100533956 (Macaca mulatta), 100533966 (Equus caballus), 101088196 (Felis catus), 4830 (Homo sapiens)
    Gene Symbols & Synonyms NME1,NB,AWD,NBS,GAAD,NDKA,NM23,NDPKA,NDPK-A,NM23-H1
    Target Alternative Names AWD,GAAD,Granzyme A-activated DNase (GAAD),Metastasis inhibition factor nm23,NB,NBS,NDK A,NDKA,NDP kinase A,NDPK-A,NDPKA,NM23,NM23-H1,NME1,Nucleoside diphosphate kinase A,Tumor metastatic process-associated protein
    Uniprot Accession P15531
    Additional SwissProt Accessions: P15531
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Metabolic pathways
    Gene Ensembl ENSMMUG00000001940, ENSECAG00000059404, ENSG00000239672
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.