Human H2AFX/H2A.X/H2A/X ORF/cDNA clone-Lentivirus plasmid (NM_002105)

Cat. No.: pGMLP000507
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human H2AFX/H2A.X/H2A/X Lentiviral expression plasmid for H2AFX lentivirus packaging, H2AFX lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Histone H2A.X/H2AX/H2AFX/H2AFX/H2A.X products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000507
Gene Name H2AFX
Accession Number NM_002105
Gene ID 3014
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 432 bp
Gene Alias H2A.X,H2A/X,H2AX
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGGGCCGCGGCAAGACTGGCGGCAAGGCCCGCGCCAAGGCCAAGTCGCGCTCGTCGCGCGCCGGCCTCCAGTTCCCAGTGGGCCGTGTACACCGGCTGCTGCGGAAGGGCCACTACGCCGAGCGCGTTGGCGCCGGCGCGCCAGTGTACCTGGCGGCAGTGCTGGAGTACCTCACCGCTGAGATCCTGGAGCTGGCGGGCAATGCGGCCCGCGACAACAAGAAGACGCGAATCATCCCCCGCCACCTGCAGCTGGCCATCCGCAACGACGAGGAGCTCAACAAGCTGCTGGGCGGCGTGACGATCGCCCAGGGAGGCGTCCTGCCCAACATCCAGGCCGTGCTGCTGCCCAAGAAGACCAGCGCCACCGTGGGGCCGAAGGCGCCCTCGGGCGGCAAGAAGGCCACCCAGGCCTCCCAGGAGTACTAA
ORF Protein Sequence MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T55244-Ab Anti-H2AFX monoclonal antibody
    Target Antigen GM-Tg-g-T55244-Ag H2AFX protein
    ORF Viral Vector pGMLP000507 Human H2AFX Lentivirus plasmid
    ORF Viral Vector pGMAP000115 Human H2AFX Adenovirus plasmid
    ORF Viral Vector vGMLP000507 Human H2AFX Lentivirus particle
    ORF Viral Vector vGMAP000115 Human H2AFX Adenovirus particle


    Target information

    Target ID GM-T55244
    Target Name Histone H2A.X/H2AX/H2AFX
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3014
    Gene ID 101095127 (Felis catus), 111774230 (Equus caballus), 15270 (Mus musculus), 3014 (Homo sapiens)
    489372 (Canis lupus familiaris), 500987 (Rattus norvegicus), 531733 (Bos taurus), 703073 (Macaca mulatta)
    Gene Symbols & Synonyms H2AX,H2ax,H2A.X,H2afx,Hist5-2ax,gammaH2ax,H2A/X,H2AFX,RGD1566119
    Target Alternative Names H2A.X,H2A/X,H2AFX,H2AX,H2a/x,H2afx,H2ax,Hist5-2ax,Histone H2A.X,Histone H2AX,RGD1566119,gammaH2ax
    Uniprot Accession P16104,P27661
    Additional SwissProt Accessions: P27661,P16104
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSMUSG00000049932, ENSG00000188486, ENSCAFG00845000497, ENSBTAG00000067452, ENSMMUG00000044496
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.