Human JPT2/C16orf34/HN1L ORF/cDNA clone-Lentivirus plasmid (NM_144570)

Cat. No.: pGMLP000508
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human JPT2/C16orf34/HN1L Lentiviral expression plasmid for JPT2 lentivirus packaging, JPT2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to HN1L/JPT2/JPT2/C16orf34 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $443.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000508
Gene Name JPT2
Accession Number NM_144570
Gene ID 90861
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 573 bp
Gene Alias C16orf34,HN1L,L11
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTCCAGGTCCCGGATAGCGAGGGCGGCCGCGCCGGCTCCAGGGCCATGAAGCCCCCAGGAGGAGAATCGAGCAATCTTTTTGGAAGTCCAGAAGAAGCTACTCCTTCCAGCAGGCCTAATAGGATGGCATCTAATATTTTTGGACCAACAGAAGAACCTCAGAACATACCCAAGAGGACAAATCCCCCAGGGGGTAAAGGAAGTGGTATCTTTGACGAATCAACCCCCGTGCAGACTCGACAGCACCTGAACCCACCTGGAGGGAAGACCAGCGACATTTTTGGGTCTCCGGTCACTGCCACTTCACGCTTGGCACACCCAAACAAACCCAAGGATCATGTTTTCTTATGTGAAGGAGAAGAACCAAAATCGGATCTTAAAGCTGCAAGGAGCATCCCGGCTGGAGCAGAGCCAGGTGAGAAAGGCAGCGCCAGAAAAGCAGGCCCCGCCAAGGAGCAGGAGCCCATGCCCACAGTCGACAGCCATGAGCCCCGGCTGGGGCCGCGGCCTCGCTCTCACAACAAGGTCCTGAACCCACCGGGAGGCAAATCCAGCATCTCCTTCTACTAA
ORF Protein Sequence MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2169-Ab Anti-JUPI2/ JPT2/ C16orf34 monoclonal antibody
    Target Antigen GM-Tg-g-MP2169-Ag JPT2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000508 Human JPT2 Lentivirus plasmid
    ORF Viral Vector pGMAP000109 Human HN1L Adenovirus plasmid
    ORF Viral Vector vGMLP000508 Human JPT2 Lentivirus particle
    ORF Viral Vector vGMAP000109 Human HN1L Adenovirus particle


    Target information

    Target ID GM-MP2169
    Target Name HN1L/JPT2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    90861
    Gene ID 100065505 (Equus caballus), 100856401 (Canis lupus familiaris), 101084505 (Felis catus), 360492 (Rattus norvegicus)
    52009 (Mus musculus), 618512 (Bos taurus), 702283 (Macaca mulatta), 90861 (Homo sapiens)
    Gene Symbols & Synonyms JPT2,Jpt2,HN1L,Hn1l,RGD1305117,C16orf34,D17Ertd441e,2810430B18Rik,L11
    Target Alternative Names 2810430B18Rik,C16orf34,D17Ertd441e,HN1L,Hematological and neurological expressed 1-like protein (HN1-like protein),Hn1l,JPT2,Jpt2,Jupiter microtubule associated homolog 2,L11,RGD1305117
    Uniprot Accession Q5BK20,Q6PGH2,Q9H910
    Additional SwissProt Accessions: Q5BK20,Q6PGH2,Q9H910
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000026941, ENSCAFG00845020882, ENSMUSG00000024165, ENSBTAG00000002209, ENSMMUG00000000979, ENSG00000206053
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.