Human AREG/AR/AREGB ORF/cDNA clone-Lentivirus plasmid (NM_001657)

Cat. No.: pGMLP000520
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human AREG/AR/AREGB Lentiviral expression plasmid for AREG lentivirus packaging, AREG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Amphiregulin/AREG/AREG/AR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $489.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000520
Gene Name AREG
Accession Number NM_001657
Gene ID 374
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 759 bp
Gene Alias AR,AREGB,CRDGF,SDGF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGAGCCCCGCTGCTACCGCCGGCGCCGGTGGTGCTGTCGCTCTTGATACTCGGCTCAGGCCATTATGCTGCTGGATTGGACCTCAATGACACCTACTCTGGGAAGCGTGAACCATTTTCTGGGGACCACAGTGCTGATGGATTTGAGGTTACCTCAAGAAGTGAGATGTCTTCAGGGAGTGAGATTTCCCCTGTGAGTGAAATGCCTTCTAGTAGTGAACCGTCCTCGGGAGCCGACTATGACTACTCAGAAGAGTATGATAACGAACCACAAATACCTGGCTATATTGTCGATGATTCAGTCAGAGTTGAACAGGTAGTTAAGCCCCCCCAAAACAAGACGGAAAGTGAAAATACTTCAGATAAACCCAAAAGAAAGAAAAAGGGAGGCAAAAATGGAAAAAATAGAAGAAACAGAAAGAAGAAAAATCCATGTAATGCAGAATTTCAAAATTTCTGCATTCACGGAGAATGCAAATATATAGAGCACCTGGAAGCAGTAACATGCAAATGTCAGCAAGAATATTTCGGTGAACGGTGTGGGGAAAAGTCCATGAAAACTCACAGCATGATTGACAGTAGTTTATCAAAAATTGCATTAGCAGCCATAGCTGCCTTTATGTCTGCTGTGATCCTCACAGCTGTTGCTGTTATTACAGTCCAGCTTAGAAGACAATACGTCAGGAAATATGAAGGAGAAGCTGAGGAACGAAAGAAACTTCGACAAGAGAATGGAAATGTACATGCTATAGCATAA
ORF Protein Sequence MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T92834-Ab Anti-AREG/ ARB/ CRDGF functional antibody
    Target Antigen GM-Tg-g-T92834-Ag AREG protein
    Cytokine cks-Tg-g-GM-T92834 amphiregulin (AREG) protein & antibody
    ORF Viral Vector pGMLP000520 Human AREG Lentivirus plasmid
    ORF Viral Vector pGMAP000225 Human AREG Adenovirus plasmid
    ORF Viral Vector vGMLP000520 Human AREG Lentivirus particle
    ORF Viral Vector vGMAP000225 Human AREG Adenovirus particle


    Target information

    Target ID GM-T92834
    Target Name Amphiregulin/AREG
    Gene Group Identifier
    （Target Gene ID in Homo species)         		374
    Gene ID 100050528 (Equus caballus), 101081041 (Felis catus), 11839 (Mus musculus), 29183 (Rattus norvegicus)
    374 (Homo sapiens), 475176 (Canis lupus familiaris), 538751 (Bos taurus), 702396 (Macaca mulatta)
    Gene Symbols & Synonyms AREG,Areg,AR,Mcub,Sdgf,SDGF,AREGB,CRDGF
    Target Alternative Names AR,AREG,AREGB,Amphiregulin,Areg,CRDGF,Colorectum cell-derived growth factor (CRDGF),Mcub,SDGF,Sdgf
    Uniprot Accession P15514,P24338,P31955
    Additional SwissProt Accessions: P31955,P24338,P15514
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer
    Disease from KEGG MAPK signaling pathway, ErbB signaling pathway, PI3K-Akt signaling pathway, Hippo signaling pathway, Colorectal cancer
    Gene Ensembl ENSECAG00000022525, ENSMUSG00000029378, ENSG00000109321, ENSCAFG00845006713, ENSBTAG00000018134, ENSMMUG00000002314
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.