Human PTHLH/BDE2/HHM ORF/cDNA clone-Lentivirus plasmid (NM_002820)

Cat. No.: pGMLP000529
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PTHLH/BDE2/HHM Lentiviral expression plasmid for PTHLH lentivirus packaging, PTHLH lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PTHLH/BDE2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $432
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000529
Gene Name PTHLH
Accession Number NM_002820
Gene ID 5744
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 528 bp
Gene Alias BDE2,HHM,PLP,PTHR,PTHRP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCGGAGACTGGTTCAGCAGTGGAGCGTCGCGGTGTTCCTGCTGAGCTACGCGGTGCCCTCCTGCGGGCGCTCGGTGGAGGGTCTCAGCCGCCGCCTCAAAAGAGCTGTGTCTGAACATCAGCTCCTCCATGACAAGGGGAAGTCCATCCAAGATTTACGGCGACGATTCTTCCTTCACCATCTGATCGCAGAAATCCACACAGCTGAAATCAGAGCTACCTCGGAGGTGTCCCCTAACTCCAAGCCCTCTCCCAACACAAAGAACCACCCCGTCCGATTTGGGTCTGATGATGAGGGCAGATACCTAACTCAGGAAACTAACAAGGTGGAGACGTACAAAGAGCAGCCGCTCAAGACACCTGGGAAGAAAAAGAAAGGCAAGCCCGGGAAACGCAAGGAGCAGGAAAAGAAAAAACGGCGAACTCGCTCTGCCTGGTTAGACTCTGGAGTGACTGGGAGTGGGCTAGAAGGGGACCACCTGTCTGACACCTCCACAACGTCGCTGGAGCTCGATTCACGGTAA
ORF Protein Sequence MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1230-Ab Anti-PTHR/ PTHLH/ BDE2 functional antibody
    Target Antigen GM-Tg-g-SE1230-Ag PTHLH protein
    ORF Viral Vector pGMLP000529 Human PTHLH Lentivirus plasmid
    ORF Viral Vector pGMLV001901 Human PTHLH Lentivirus plasmid
    ORF Viral Vector pGMAP000211 Human PTHLH Adenovirus plasmid
    ORF Viral Vector vGMLP000529 Human PTHLH Lentivirus particle
    ORF Viral Vector vGMLV001901 Human PTHLH Lentivirus particle
    ORF Viral Vector vGMAP000211 Human PTHLH Adenovirus particle


    Target information

    Target ID GM-SE1230
    Target Name PTHLH
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5744
    Gene ID 100033979 (Equus caballus), 19227 (Mus musculus), 24695 (Rattus norvegicus), 286767 (Bos taurus)
    403987 (Canis lupus familiaris), 554222 (Felis catus), 5744 (Homo sapiens), 710295 (Macaca mulatta)
    Gene Symbols & Synonyms PTHLH,Pthlh,PTHrP,PLP,Pthrp,PTH-like,PTHRP,HHM,BDE2,PTHR
    Target Alternative Names BDE2,HHM,PLP,PTH-like,PTH-rP,PTHLH,PTHR,PTHRP,PTHrP,Parathyroid hormone-like protein (PLP),Parathyroid hormone-related protein,Pthlh,Pthrp
    Uniprot Accession P12272,P13085,P22858,P52211,P58073,Q9GMB7
    Additional SwissProt Accessions: Q9GMB7,P22858,P13085,P58073,P52211,P12272
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease cancer, Lung cancer
    Disease from KEGG Parathyroid hormone synthesis, secretion and action
    Gene Ensembl ENSECAG00000014708, ENSMUSG00000048776, ENSBTAG00000006538, ENSCAFG00845022996, ENSG00000087494, ENSMMUG00000010531
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.