Human IL7/IL-7 ORF/cDNA clone-Lentivirus plasmid (NM_000880)

Cat. No.: pGMLP000532
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL7/IL-7 Lentiviral expression plasmid for IL7 lentivirus packaging, IL7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-7/IL7/IL7/IL-7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $433.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000532
Gene Name IL7
Accession Number NM_000880
Gene ID 3574
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 534 bp
Gene Alias IL-7
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTCCATGTTTCTTTTAGGTATATCTTTGGACTTCCTCCCCTGATCCTTGTTCTGTTGCCAGTAGCATCATCTGATTGTGATATTGAAGGTAAAGATGGCAAACAATATGAGAGTGTTCTAATGGTCAGCATCGATCAATTATTGGACAGCATGAAAGAAATTGGTAGCAATTGCCTGAATAATGAATTTAACTTTTTTAAAAGACATATCTGTGATGCTAATAAGGAAGGTATGTTTTTATTCCGTGCTGCTCGCAAGTTGAGGCAATTTCTTAAAATGAATAGCACTGGTGATTTTGATCTCCACTTATTAAAAGTTTCAGAAGGCACAACAATACTGTTGAACTGCACTGGCCAGGTTAAAGGAAGAAAACCAGCTGCCCTGGGTGAAGCCCAACCAACAAAGAGTTTGGAAGAAAATAAATCTTTAAAGGAACAGAAAAAACTGAATGACTTGTGTTTCCTAAAGAGACTATTACAAGAGATAAAAACTTGTTGGAATAAAATTTTGATGGGCACTAAAGAACACTGA
ORF Protein Sequence MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T35232-Ab Anti-IL7/ IL-7 functional antibody
    Target Antigen GM-Tg-g-T35232-Ag IL7 protein
    ORF Viral Vector pGMLP000532 Human IL7 Lentivirus plasmid
    ORF Viral Vector pGMLV001094 Human IL7 Lentivirus plasmid
    ORF Viral Vector pGMAP000249 Human IL7 Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-010 Human IL7 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-093 Human IL7 Adenovirus plasmid
    ORF Viral Vector vGMLP000532 Human IL7 Lentivirus particle
    ORF Viral Vector vGMLV001094 Human IL7 Lentivirus particle
    ORF Viral Vector vGMAP000249 Human IL7 Adenovirus particle
    ORF Viral Vector vGMLP-IL-010 Human IL7 Lentivirus particle
    ORF Viral Vector vGMAP-IL-093 Human IL7 Adenovirus particle


    Target information

    Target ID GM-T35232
    Target Name IL-7/IL7
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3574
    Gene ID 100059131 (Equus caballus), 101084597 (Felis catus), 16196 (Mus musculus), 25647 (Rattus norvegicus)
    280827 (Bos taurus), 3574 (Homo sapiens), 574168 (Macaca mulatta), 751768 (Canis lupus familiaris)
    Gene Symbols & Synonyms IL7,Il7,Il-7,hlb368,A630026I06Rik,IL-7,IMD130
    Target Alternative Names A630026I06Rik,IL-7,IL7,IMD130,Il-7,Il7,Interleukin-7,hlb368
    Uniprot Accession P10168,P13232,P26895,P56478
    Additional SwissProt Accessions: P10168,P56478,P26895,P13232
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer, ovarian cancer, Overactive bladder
    Disease from KEGG Cytokine-cytokine receptor interaction, PI3K-Akt signaling pathway, JAK-STAT signaling pathway, Hematopoietic cell lineage, Pathways in cancer
    Gene Ensembl ENSECAG00000020767, ENSMUSG00000040329, ENSBTAG00000016284, ENSG00000104432, ENSMMUG00000001655, ENSCAFG00845029605
    Target Classification Cytokine Receptor


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.